Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-Human Activin betac-Subunit Antibody, clone betaC clone 1    

Anti-Human Activin betac-Subunit Antibody, clone betaC clone 1

Mouse Anti-Human Monoclonal Antibody

Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P55103
Reactivity Human
Host Mouse
Clonality Monoclonal
Isotype IgG1
Clone Names betaC clone 1
Calculated MW 38238 Da
Additional Information
Other Species Rat
Purification Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
Immunogen Synthetic peptide sequence VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC corresponding to amino acids 82-113 of mature human activin BetaC-subunit.
Shelf Life 18 months from date of despatch.
Gene ID 3626
Other Names Inhibin beta C chain, Activin beta-C chain, INHBC
Target/Specificity Mouse anti-Human Activin betaC-subunit antibody, clone betaC clone 1 recognizes the BetaC-subunit of Activin (BetaC-activin), a member of the transforming growth factor beta (TGF-beta) superfamily and one of a group of proteins which regulate growth and differentiation in a range of cells and tissues, via both autocrine and paracrine pathways. Activins were originally characterised by the formation of specific homo- and heterodimers of activin BetaA- or BetaB-subunits, but additional subunits of activin have since been identified including BetaC, BetaD and BetaE. BetaC-activin, expressed in the liver, prostrate, ovary and testis, has been shown to exhibit both growth promoting and inhibitory properties, and evidence suggests that BetaC-activin can form BetaC homodimers and also heterodimers with BetaA (putative activin AC) and BetaB (putative activin BC). Clone betaC clone 1 has been shown to recognize both monomeric and dimeric BetaC-activin and does not cross react with BetaAf, BetaB or BetaE.
Preservative & Stabilisers 0.09% Sodium Azide
Storage Store at +4℃ or at -20 ℃.
PrecautionsAnti-Human Activin betac-Subunit Antibody, clone betaC clone 1 is for research use only and not for use in diagnostic or therapeutic procedures.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


1. Mellor, S.L. et al. (2000) Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in human prostate and evidence for formation of new activin heterodimers of beta(C)-subunit.
J. Clin. Endocrinol. Metab. 85: 4851-4858. 2. Mellor, S.L. et al. (2003) Activin betaC-subunit heterodimers provide a new mechanism of regulating activin levels in the prostate.
Endocrinology. 144: 4410-4419. 3. Gold, E.J. et al. (2005) BetaA- and BetaC-activin, follistatin, activin receptor mRNA and BetaC-activin peptide expression during rat liver regeneration.
J. Mol. Endocrinol. 34: 505-515.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

Cat# ABD10176
(40 western blots)
Availability: Inquire
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Santa Cruz Alternative
Terms & Conditions