Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Immunology   >   Anti-Human Interleukin-21 Receptor (N-Terminal) Antibody    

Anti-Human Interleukin-21 Receptor (N-Terminal) Antibody

Goat Anti-Human Polyclonal Antibody

  • IHC - Anti-Human Interleukin-21 Receptor (N-Terminal) Antibody  ABD11156
    Staining of paraffin embedded human lung with Goat anti human interleukin-21 receptor (N-terminal)
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q9HBE5
Reactivity Human
Host Goat
Clonality Polyclonal
Isotype Polyclonal IgG
Calculated MW 59130 Da
Additional Information
Purification Antiserum to human IL-21R (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
Immunogen Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R.
Shelf Life 18 months from date of despatch.
Gene ID 50615
Other Names Interleukin-21 receptor, IL-21 receptor, IL-21R, Novel interleukin receptor, CD360, IL21R, NILR
Target/Specificity Rabbit anti-Human interleukin-21 receptor antibody recognizes an epitope within the N-terminal (NT) region of human interleukin-21 receptor (IL-21R), a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21.Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.
Preservative & Stabilisers 0.1% Sodium Azide (NaN3); 0.1% Bovine Serum Albumin;
Storage Store at -20℃ only.
PrecautionsAnti-Human Interleukin-21 Receptor (N-Terminal) Antibody is for research use only and not for use in diagnostic or therapeutic procedures.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


1. Coit P et al. (2015) DNA methylation analysis of the temporal artery microenvironment in giant cell arteritis.
Ann Rheum Dis. pii: annrheumdis-2014-207116.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

Cat# ABD11156
Availability: Inquire
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions