> home > Products > Primary Antibodies > Signal Transduction > Anti-Human CD284 (N-Terminal) Antibody
Anti-Human CD284 (N-Terminal) Antibody
Goat Anti-Human Polyclonal Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application ![]()
| WB, IHC-P |
---|---|
Primary Accession | O00206 |
Reactivity | Human |
Host | Goat |
Clonality | Polyclonal |
Isotype | Polyclonal IgG |
Calculated MW | 95680 Da |
Other Species | M,Rat |
---|---|
Purification | Antiserum to human CD284 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography. |
Immunogen | Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284. |
Shelf Life | 18 months from date of despatch. |
Gene ID | 7099 |
Other Names | Toll-like receptor 4, hToll, CD284, TLR4 |
Target/Specificity | Goat anti-Human CD284 antibody recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kDa single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity (UniProt: O00206).Goat anti-Human CD284 antibody recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling.Goat anti-Human CD284 antibody is reported to be suitable for use in immunocytochemistry on acetone fixed cells. |
Preservative & Stabilisers | 0.1% Sodium Azide (NaN3); 0.1% Bovine Serum Albumin; |
Storage | Store at +4℃ or at -20 ℃. |
Precautions | Anti-Human CD284 (N-Terminal) Antibody is for research use only and not for use in diagnostic or therapeutic procedures. |
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.
info@abgent.com, and receive a free "I Love Antibodies" mug.
Application Protocols
Provided below are standard protocols that you may find useful for product applications.

Abgent welcomes feedback from its customers.
If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abgent.com.
$ 355.00
Cat# ABD11159
Ordering Information
United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900
Other Products
Shipping Information
Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors