Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   Anti-Calpastatin Picoband Antibody   

Anti-Calpastatin Picoband Antibody

     
  • WB - Anti-Calpastatin Picoband Antibody ABO10059
    Western blot analysis of Calpastatin expression in COLO320 whole cell lysates (lane 1). Calpastatin at 100KD was detected using rabbit anti- Calpastatin Antigen Affinity purified polyclonal antibody (Catalog # ABO10059) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method .
    detail
  • IHC - Anti-Calpastatin Picoband Antibody ABO10059
    Calpastatin was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- Calpastatin Antigen Affinity purified polyclonal antibody (Catalog # ABO10059) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • IHC - Anti-Calpastatin Picoband Antibody ABO10059
    Calpastatin was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- Calpastatin Antigen Affinity purified polyclonal antibody (Catalog # ABO10059) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession P20810
Host Rabbit
Reactivity Human
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Calpastatin(CAST) detection. Tested with WB, IHC-P in Human.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 831
Other Names Calpastatin, Calpain inhibitor, Sperm BS-17 component, CAST
Calculated MW 76573 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, By Heat

Western blot, 0.1-0.5 µg/ml, Human
Protein Name Calpastatin
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin (275-310aa QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by eleven amino
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name CAST
Function Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Calpastatin is a protein that in humans is encoded by the CAST gene. It is mapped to 5q15. The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 280.00
Cat# ABO10059
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"