Anti-Annexin VII Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB |
---|---|
Primary Accession | P20073 |
Host | Rabbit |
Reactivity | Human |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Annexin A7(ANXA7) detection. Tested with WB in Human. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 310 |
---|---|
Other Names | Annexin A7, Annexin VII, Annexin-7, Synexin, ANXA7, ANX7, SNX |
Calculated MW | 52739 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human |
Tissue Specificity | Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta. . |
Protein Name | Annexin A7 |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VII (434-466aa TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL), different from the related mouse sequence by one amino acid. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | ANXA7 |
---|---|
Synonyms | ANX7, SNX |
Function | Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. |
Tissue Location | Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
ANXA7 (Annexin A7), also known as ANX7 or SNX, is a protein that in humans is encoded by the ANXA7 gene. Annexin VII is a member of the annexin family of calcium-dependent phospholipid binding proteins. This gene is mapped to 10q21.1-q21.2 by study of somatic cell hybrids and by in situ hybridization. The ANX7 gene exhibits many biologic and genetic properties expected of a tumor suppressor gene and may play a role in prostate cancer progression. Based on studies of recombinant human ANXA7 and isolated bovine chromaffin cells, it is showed that ANXA7 is a Ca(2+)-dependent GTP binding protein. ANXA7 was active in a chromaffin granule aggregation assays in the presence of Ca(2+) and GTP, and was deactivated upon GTP hydrolysis.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.