Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Stem Cells   >   Anti-B7-1/CD80 Antibody   

Anti-B7-1/CD80 Antibody

     
  • WB - Anti-B7-1/CD80 Antibody ABO10689
    Anti-CD80 antibody, ABO10689, Western blottingLane 1: Recombinant Human CD80 Protein 10ngLane 2: Recombinant Human CD80 Protein 5ngLane 3: Recombinant Human CD80 Protein 2.5ng
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession P33681
Host Rabbit
Reactivity Human
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for T-lymphocyte activation antigen CD80(CD80) detection. Tested with WB in Human.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Other Names T-lymphocyte activation antigen CD80, Activation B7-1 antigen, BB1, CTLA-4 counter-receptor B7.1, B7, CD80, CD80, CD28LG, CD28LG1, LAB7
Calculated MW 33048 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human
Subcellular Localization Membrane; Single-pass type I membrane protein.
Tissue Specificity Expressed on activated B-cells, macrophages and dendritic cells.
Protein Name T-lymphocyte activation antigen CD80
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human CD80(57-71aa EELAQTRIYWQKEKK).
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Sequence Similarities Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Protein Information
Name CD80
Synonyms CD28LG, CD28LG1, LAB7
Function Involved in the costimulatory signal essential for T- lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation.
Cellular Location Membrane; Single-pass type I membrane protein
Tissue Location Expressed on activated B-cells, macrophages and dendritic cells EMBL; M27533; AAA36045.1; -; mRNA EMBL; M83077; AAA58390.1; -; Genomic_DNA EMBL; M83072; AAA58390.1; JOINED; Genomic_DNA EMBL; M83073; AAA58390.1; JOINED; Genomic_DNA EMBL; M83074; AAA58390.1; JOINED; Genomic_DNA EMBL; AY197777; AAO39208.1; -; mRNA EMBL; AY197778; AAO39209.1; -; mRNA EMBL; AC073352; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC042665; AAH42665.1; -; mRNA CCDS; CCDS2989.1; -. [P33681-1] PIR; I54495; A45803 RefSeq; NP_005182.1; NM_005191.3. [P33681-1] UniGene; Hs.838; - PDB; 1DR9; X-ray; 3.00 A; A=35-233 PDB; 1I8L; X-ray; 3.00 A; A/B=35-242 PDBsum; 1DR9; - PDBsum; 1I8L; - ProteinModelPortal; P33681; - SMR; P33681; - BioGrid; 107379; 75 DIP; DIP-6044N; - IntAct; P33681; 5 STRING; 9606.ENSP00000264246; - ChEMBL; CHEMBL2364157; - DrugBank; DB01281; Abatacept DrugBank; DB06681; Belatacept DrugBank; DB04901; Galiximab GuidetoPHARMACOLOGY; 2744; - iPTMnet; P33681; - PhosphoSitePlus; P33681; - BioMuta; CD80; - DMDM; 461606; - PaxDb; P33681; - PeptideAtlas; P33681; - PRIDE; P33681; - ProteomicsDB; 54922; - Ensembl; ENST00000264246; ENSP00000264246; ENSG00000121594. [P33681-1] Ensembl; ENST00000383669; ENSP00000373165; ENSG00000121594. [P33681-2] Ensembl; ENST00000478182; ENSP00000418364; ENSG00000121594. [P33681-1] GeneID; 941; - KEGG; hsa:941; - UCSC; uc003ecq.4; human. [P33681-1] CTD; 941; - DisGeNET; 941; - EuPathDB; HostDB:ENSG00000121594.11; - GeneCards; CD80; - HGNC; HGNC:1700; CD80 HPA; CAB025368; - HPA; HPA050092; - MIM; 112203; gene neXtProt; NX_P33681; - OpenTargets; ENSG00000121594; - PharmGKB; PA26239; - eggNOG; ENOG410J3XE; Eukaryota eggNOG; ENOG411154Z; LUCA GeneTree; ENSGT00720000108819; - HOGENOM; HOG000036959; - HOVERGEN; HBG000261; - InParanoid; P33681; - KO; K05412; - OMA; VRIYWQK; - OrthoDB; EOG091G0QRI; - PhylomeDB; P33681; - TreeFam; TF351094; - Reactome; R-HSA-1257604; PIP3 activates AKT signaling Reactome; R-HSA-2219530; Constitutive Signaling by Aberrant PI3K in Cancer Reactome; R-HSA-389356; CD28 co-stimulation Reactome; R-HSA-389357; CD28 dependent PI3K/Akt signaling Reactome; R-HSA-389359; CD28 dependent Vav1 pathway Reactome; R-HSA-389513; CTLA4 inhibitory signaling Reactome; R-HSA-6783783; Interleukin-10 signaling Reactome; R-HSA-6811558; PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling SIGNOR; P33681; - EvolutionaryTrace; P33681; - GeneWiki; CD80; - GenomeRNAi; 941; - PRO; PR:P33681; - Proteomes; UP000005640; Chromosome 3 Bgee; ENSG00000121594; - CleanEx; HS_CD80; - ExpressionAtlas; P33681; baseline and differential Genevisible; P33681; HS GO; GO:0009986; C:cell surface; HDA:UniProtKB GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW GO; GO:0005622; C:intracellular; IEA:GOC GO; GO:0005886; C:plasma membrane; TAS:Reactome GO; GO:0098636; C:protein complex involved in cell adhesion; IDA:MGI GO; GO:0015026; F:coreceptor activity; NAS:UniProtKB GO; GO:0046934; F:phosphatidylinositol-4,5-bisphosphate 3-kinase activity; TAS:Reactome GO; GO:0001618; F:virus receptor activity; IEA:UniProtKB-KW GO; GO:0019221; P:cytokine-mediated signaling pathway; TAS:Reactome GO; GO:0035556; P:intracellular signal transduction; NAS:UniProtKB GO; GO:0045425; P:positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process; NAS:UniProtKB GO; GO:0045086; P:positive regulation of interleukin-2 biosynthetic process; NAS:UniProtKB GO; GO:0050731; P:positive regulation of peptidyl-tyrosine phosphorylation; IDA:UniProtKB GO; GO:0051897; P:positive regulation of protein kinase B signaling; TAS:Reactome GO; GO:0009967; P:positive regulation of signal transduction; NAS:UniProtKB GO; GO:0045627; P:positive regulation of T-helper 1 cell differentiation; NAS:UniProtKB GO; GO:0045893; P:positive regulation of transcription, DNA-templated; NAS:UniProtKB GO; GO:0031295; P:T cell costimulation; TAS:Reactome CDD; cd16083; IgC_CD80; 1 Gene3D; 2.60.40.10; -; 2 InterPro; IPR013162; CD80_C2-set InterPro; IPR037676; CD80_IgC InterPro; IPR007110; Ig-like_dom InterPro; IPR036179; Ig-like_dom_sf InterPro; IPR013783; Ig-like_fold InterPro; IPR003599; Ig_sub InterPro; IPR013106; Ig_V-set Pfam; PF08205; C2-set_2; 1 Pfam; PF07686; V-set; 1 SMART; SM00409; IG; 1 SUPFAM; SSF48726; SSF48726; 2 PROSITE; PS50835; IG_LIKE; 2 1: Evidence at protein level; 3D-structure; Alternative splicing; Complete proteome; Direct protein sequencing; Disulfide bond; Glycoprotein; Host cell receptor for virus entry; Host-virus interaction; Immunoglobulin domain; Membrane; Phosphoprotein; Receptor; Reference proteome; Signal; Transmembrane; Transmembrane helix SIGNAL 1 34 CHAIN 35 288 T-lymphocyte activation antigen CD80 /FTId=PRO_0000014547 TOPO_DOM 35 242 Extracellular. TRANSMEM 243 263 Helical. TOPO_DOM 264 288 Cytoplasmic. DOMAIN 35 135 Ig-like V-type DOMAIN 145 230 Ig-like C2-type MOD_RES 284 284 Phosphoserine CARBOHYD 53 53 N-linked (GlcNAc...) asparagine CARBOHYD 89 89 N-linked (GlcNAc...) asparagine CARBOHYD 98 98 N-linked (GlcNAc...) asparagine CARBOHYD 186 186 N-linked (GlcNAc...) asparagine CARBOHYD 207 207 N-linked (GlcNAc...) asparagine CARBOHYD 211 211 N-linked (GlcNAc...) asparagine CARBOHYD 226 226 N-linked (GlcNAc...) asparagine CARBOHYD 232 232 N-linked (GlcNAc...) asparagine DISULFID 50 116 {ECO:0000255|PROSITE-ProRule:PRU00114, ECO:0000269|PubMed:11279502} DISULFID 162 216 {ECO:0000255|PROSITE-ProRule:PRU00114, ECO:0000269|PubMed:11279502} VAR_SEQ 140 140 A -> G (in isoform 3) /FTId=VSP_047698 VAR_SEQ 141 266 Missing (in isoform 3) /FTId=VSP_047699 VAR_SEQ 234 266 TKQEHFPDNLLPSWAITLISVNGIFVICCLTYC -> S (in isoform 2) /FTId=VSP_047700 STRAND 37 41 {ECO:0000244|PDB:1DR9} STRAND 46 48 {ECO:0000244|PDB:1DR9} HELIX 58 61 {ECO:0000244|PDB:1DR9} STRAND 63 68 {ECO:0000244|PDB:1DR9} STRAND 71 77 {ECO:0000244|PDB:1DR9} STRAND 80 83 {ECO:0000244|PDB:1DR9} HELIX 85 88 {ECO:0000244|PDB:1DR9} STRAND 91 95 {ECO:0000244|PDB:1DR9} TURN 96 99 {ECO:0000244|PDB:1DR9} STRAND 100 103 {ECO:0000244|PDB:1DR9} HELIX 108 110 {ECO:0000244|PDB:1DR9} STRAND 112 120 {ECO:0000244|PDB:1DR9} STRAND 127 139 {ECO:0000244|PDB:1DR9} STRAND 146 151 {ECO:0000244|PDB:1DR9} STRAND 157 169 {ECO:0000244|PDB:1DR9} STRAND 171 179 {ECO:0000244|PDB:1DR9} STRAND 185 191 {ECO:0000244|PDB:1DR9} TURN 193 195 {ECO:0000244|PDB:1DR9} STRAND 198 207 {ECO:0000244|PDB:1DR9} STRAND 212 220 {ECO:0000244|PDB:1DR9} STRAND 225 231 {ECO:0000244|PDB:1DR9} SEQUENCE 288 AA; 33048 MW; BA453EE34528B1F4 CRC64; MGHTRRQGTS PSKCPYLNFF QLLVLAGLSH FCSGVIHVTK EVKEVATLSC GHNVSVEELA QTRIYWQKEK KMVLTMMSGD MNIWPEYKNR TIFDITNNLS IVILALRPSD EGTYECVVLK YEKDAFKREH LAEVTLSVKA DFPTPSISDF EIPTSNIRRI ICSTSGGFPE PHLSWLENGE ELNAINTTVS QDPETELYAV SSKLDFNMTT NHSFMCLIKY GHLRVNQTFN WNTTKQEHFP DNLLPSWAIT LISVNGIFVI CCLTYCFAPR CRERRRNERL RRESVRPV
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Cluster of Differentiation 80(also CD80 and B7-1) is a protein found on activated B cells and monocytes that provides a costimulatory signal necessary for T cell activation and survival. It is the ligand for two different proteins on the T cell surface: CD28(for autoregulation and intercellular association) and CTLA-4(for attenuation of regulation and cellular disassociation). CD80 works in tandem with CD86 to prime T cells. The CD80 genes encode B7-1 which are structurally similar members of the immunoglobulin superfamily expressed on a variety of hematopoietic cell types. Reeves et al.(1997) stated that B7-1 and B7-2 provide a costimulatory signal to T cells by interacting with CD28 and CTLA4.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 240.00
Cat# ABO10689
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions