Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   Anti-ICA1 Picoband Antibody   

Anti-ICA1 Picoband Antibody

     
  • WB - Anti-ICA1 Picoband Antibody ABO12183
    Anti- ICA1 Picoband antibody, ABO12183, Western blottingAll lanes: Anti ICA1 (ABO12183) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Pancreas Tissue Lysate at 50ugPredicted bind size: 55KDObserved bind size: 55KD
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession Q05084
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Other Names Islet cell autoantigen 1, 69 kDa islet cell autoantigen, ICA69, Islet cell autoantigen p69, ICAp69, p69, ICA1
Calculated MW 54645 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Mouse, Rat, Human
Subcellular Localization Cytoplasm, cytosol . Golgi apparatus membrane ; Peripheral membrane protein . Cytoplasmic vesicle, secretory vesicle membrane ; Peripheral membrane protein . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Peripheral membrane protein . Predominantly cytosolic. Also exists as a membrane-bound form which has been found associated with synaptic vesicles and also with the Golgi complex and immature secretory granules.
Tissue Specificity Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.
Protein Name Islet cell autoantigen 1
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name ICA1
Function May play a role in neurotransmitter secretion.
Cellular Location Cytoplasm, cytosol. Golgi apparatus membrane; Peripheral membrane protein Cytoplasmic vesicle, secretory vesicle membrane; Peripheral membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Peripheral membrane protein. Note=Predominantly cytosolic. Also exists as a membrane-bound form which has been found associated with synaptic vesicles and also with the Golgi complex and immature secretory granules
Tissue Location Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid EMBL; L01100; AAA02564.1; -; mRNA EMBL; L21181; AAA64927.1; -; mRNA EMBL; U26591; AAB19033.1; -; mRNA EMBL; U37183; AAC50935.1; -; mRNA EMBL; U71264; AAB94738.1; -; Genomic_DNA EMBL; U71251; AAB94738.1; JOINED; Genomic_DNA EMBL; U71252; AAB94738.1; JOINED; Genomic_DNA EMBL; U71253; AAB94738.1; JOINED; Genomic_DNA EMBL; U71255; AAB94738.1; JOINED; Genomic_DNA EMBL; U71256; AAB94738.1; JOINED; Genomic_DNA EMBL; U71257; AAB94738.1; JOINED; Genomic_DNA EMBL; U71258; AAB94738.1; JOINED; Genomic_DNA EMBL; U71259; AAB94738.1; JOINED; Genomic_DNA EMBL; U71260; AAB94738.1; JOINED; Genomic_DNA EMBL; U71261; AAB94738.1; JOINED; Genomic_DNA EMBL; U71262; AAB94738.1; JOINED; Genomic_DNA EMBL; U71263; AAB94738.1; JOINED; Genomic_DNA EMBL; EU416199; ACB47390.1; -; mRNA EMBL; AK292106; BAF84795.1; -; mRNA EMBL; AC006042; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC007009; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471073; EAW93610.1; -; Genomic_DNA EMBL; CH471073; EAW93617.1; -; Genomic_DNA EMBL; BC008640; AAH08640.1; -; mRNA CCDS; CCDS34602.1; -. [Q05084-1] CCDS; CCDS64595.1; -. [Q05084-3] PIR; I55598; I55598 RefSeq; NP_001129492.1; NM_001136020.2. [Q05084-1] RefSeq; NP_001263407.1; NM_001276478.1. [Q05084-3] RefSeq; NP_004959.2; NM_004968.3. [Q05084-1] RefSeq; NP_071682.1; NM_022307.2. [Q05084-1] RefSeq; XP_005249792.1; XM_005249735.3 RefSeq; XP_011513647.1; XM_011515345.1 RefSeq; XP_011513648.1; XM_011515346.1 RefSeq; XP_011513649.1; XM_011515347.2. [Q05084-2] RefSeq; XP_011513650.1; XM_011515348.1. [Q05084-2] RefSeq; XP_011513651.1; XM_011515349.1. [Q05084-2] RefSeq; XP_016867606.1; XM_017012117.1 RefSeq; XP_016867607.1; XM_017012118.1 RefSeq; XP_016867608.1; XM_017012119.1 RefSeq; XP_016867609.1; XM_017012120.1 RefSeq; XP_016867610.1; XM_017012121.1 UniGene; Hs.487561; - ProteinModelPortal; Q05084; - SMR; Q05084; - BioGrid; 109609; 14 IntAct; Q05084; 13 STRING; 9606.ENSP00000379908; - iPTMnet; Q05084; - PhosphoSitePlus; Q05084; - BioMuta; ICA1; - DMDM; 20141584; - MaxQB; Q05084; - PaxDb; Q05084; - PeptideAtlas; Q05084; - PRIDE; Q05084; - ProteomicsDB; 58305; - DNASU; 3382; - Ensembl; ENST00000265577; ENSP00000265577; ENSG00000003147. [Q05084-3] Ensembl; ENST00000396675; ENSP00000379908; ENSG00000003147. [Q05084-1] Ensembl; ENST00000402384; ENSP00000385570; ENSG00000003147. [Q05084-1] Ensembl; ENST00000406470; ENSP00000385651; ENSG00000003147. [Q05084-1] Ensembl; ENST00000422063; ENSP00000403982; ENSG00000003147. [Q05084-2] GeneID; 3382; - KEGG; hsa:3382; - UCSC; uc003srm.4; human. [Q05084-1] CTD; 3382; - DisGeNET; 3382; - EuPathDB; HostDB:ENSG00000003147.17; - GeneCards; ICA1; - HGNC; HGNC:5343; ICA1 HPA; HPA017646; - HPA; HPA061452; - MIM; 147625; gene neXtProt; NX_Q05084; - OpenTargets; ENSG00000003147; - PharmGKB; PA29591; - eggNOG; KOG3891; Eukaryota eggNOG; ENOG410YJKW; LUCA GeneTree; ENSGT00390000005530; - HOGENOM; HOG000006612; - HOVERGEN; HBG061005; - InParanoid; Q05084; - KO; K19863; - OMA; HESFRGY; - OrthoDB; EOG091G0BDC; - PhylomeDB; Q05084; - TreeFam; TF317186; - ChiTaRS; ICA1; human GeneWiki; ICA1; - GenomeRNAi; 3382; - PRO; PR:Q05084; - Proteomes; UP000005640; Chromosome 7 Bgee; ENSG00000003147; - CleanEx; HS_ICA1; - ExpressionAtlas; Q05084; baseline and differential Genevisible; Q05084; HS GO; GO:0030054; C:cell junction; IEA:UniProtKB-KW GO; GO:0005737; C:cytoplasm; TAS:ProtInc GO; GO:0005829; C:cytosol; IDA:HPA GO; GO:0000139; C:Golgi membrane; IDA:UniProtKB GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA GO; GO:0030667; C:secretory granule membrane; IDA:UniProtKB GO; GO:0030672; C:synaptic vesicle membrane; ISS:UniProtKB GO; GO:0019904; F:protein domain specific binding; IEA:InterPro GO; GO:0006836; P:neurotransmitter transport; IEA:UniProtKB-KW GO; GO:0050796; P:regulation of insulin secretion; IEA:InterPro Gene3D; 1.20.1270.60; -; 1 InterPro; IPR027267; AH/BAR_dom_sf InterPro; IPR010504; AH_dom InterPro; IPR030796; ICA1 InterPro; IPR024114; Islet_autoAg_Ica1/Ica1-like InterPro; IPR006723; Islet_autoAg_Ica1_C PANTHER; PTHR10164; PTHR10164; 1 PANTHER; PTHR10164:SF3; PTHR10164:SF3; 1 Pfam; PF06456; Arfaptin; 1 Pfam; PF04629; ICA69; 2 SMART; SM01015; Arfaptin; 1 SMART; SM01237; ICA69; 1 SUPFAM; SSF103657; SSF103657; 1 PROSITE; PS50870; AH; 1 1: Evidence at protein level; Alternative splicing; Cell junction; Complete proteome; Cytoplasm; Cytoplasmic vesicle; Golgi apparatus; Membrane; Neurotransmitter transport; Reference proteome; Synapse; Transport CHAIN 1 483 Islet cell autoantigen 1 /FTId=PRO_0000084130 DOMAIN 51 254 AH. {ECO:0000255|PROSITE- ProRule:PRU00294} VAR_SEQ 7 7 Missing (in isoform 3) /FTId=VSP_055405 VAR_SEQ 301 301 Q -> QYLQNICLEMKANSDIKMLQKGKEGQQIGI (in isoform 2). {ECO:0000303|Ref.4} /FTId=VSP_047761 CONFLICT 29 29 K -> R (in Ref. 1; AAA02564) CONFLICT 83 83 R -> G (in Ref. 2; AAA64927) SEQUENCE 483 AA; 54645 MW; 1696F928EE7454C9 CRC64; MSGHKCSYPW DLQDRYAQDK SVVNKMQQKY WETKQAFIKA TGKKEDEHVV ASDADLDAKL ELFHSIQRTC LDLSKAIVLY QKRICFLSQE ENELGKFLRS QGFQDKTRAG KMMQATGKAL CFSSQQRLAL RNPLCRFHQE VETFRHRAIS DTWLTVNRME QCRTEYRGAL LWMKDVSQEL DPDLYKQMEK FRKVQTQVRL AKKNFDKLKM DVCQKVDLLG ASRCNLLSHM LATYQTTLLH FWEKTSHTMA AIHESFKGYQ PYEFTTLKSL QDPMKKLVEK EEKKKINQQE STDAAVQEPS QLISLEEENQ RKESSSFKTE DGKSILSALD KGSTHTACSG PIDELLDMKS EEGACLGPVA GTPEPEGADK DDLLLLSEIF NASSLEEGEF SKEWAAVFGD GQVKEPVPTM ALGEPDPKAQ TGSGFLPSQL LDQNMKDLQA SLQEPAKAAS DLTAWFSLFA DLDPLSNPDA VGKTDKEHEL LNA
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What’s more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 240.00
Cat# ABO12183
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions