Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   Anti-Otoferlin Picoband Antibody   

Anti-Otoferlin Picoband Antibody

     
  • WB - Anti-Otoferlin Picoband Antibody ABO12302
    Anti- Otoferlin Picoband antibody, ABO12302, Western blottingAll lanes: Anti Otoferlin (ABO12302) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: 293T Whole Cell Lysate at 40ugPredicted bind size: 227KDObserved bind size: 227KD
    detail
  • IHC - Anti-Otoferlin Picoband Antibody ABO12302
    Anti- Otoferlin Picoband antibody, ABO12302,IHC(P)IHC(P): Mouse Brain Tissue
    detail
  • IHC - Anti-Otoferlin Picoband Antibody ABO12302
    Anti- Otoferlin Picoband antibody, ABO12302,IHC(P)IHC(P): Rat Brain Tissue
    detail
  • IHC - Anti-Otoferlin Picoband Antibody ABO12302
    Anti- Otoferlin Picoband antibody, ABO12302,IHC(P)IHC(P): Human Glioma Tissue
    detail
  • SPECIFICATION
  • CITATIONS: 1
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession Q9HC10
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Otoferlin(OTOF) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 9381
Other Names Otoferlin, Fer-1-like protein 2, OTOF, FER1L2
Calculated MW 226753 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Rat
Subcellular Localization Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Single-pass type II membrane protein . Basolateral cell membrane ; Single-pass type II membrane protein . Endoplasmic reticulum membrane ; Single-pass type II membrane protein . Cell membrane ; Single-pass type II membrane protein . Detected at basolateral cell membrane with synaptic vesicles surrounding the ribbon and at the presynaptic plasma membrane in the inner hair cells (IHCs). Colocalizes with GPR25 and RAB8B in inner hair cells (By similarity). .
Tissue Specificity Isoform 1 and isoform 3 are found in adult brain. Isoform 2 is expressed in the fetus and in adult brain, heart, placenta, skeletal muscle and kidney.
Protein Name Otoferlin
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Otoferlin (1831-1863aa QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ), identical to the related mouse and rat sequences.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Sequence Similarities Belongs to the ferlin family.
Protein Information
Name OTOF
Synonyms FER1L2
Function Key calcium ion sensor involved in the Ca(2+)-triggered synaptic vesicle-plasma membrane fusion and in the control of neurotransmitter release at these output synapses. Interacts in a calcium-dependent manner to the presynaptic SNARE proteins at ribbon synapses of cochlear inner hair cells (IHCs) to trigger exocytosis of neurotransmitter. Also essential to synaptic exocytosis in immature outer hair cells (OHCs). May also play a role within the recycling of endosomes (By similarity).
Cellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane {ECO:0000250|UniProtKB:Q9ESF1}; Single-pass type II membrane protein {ECO:0000250|UniProtKB:Q9ESF1}. Basolateral cell membrane {ECO:0000250|UniProtKB:Q9ESF1}; Single-pass type II membrane protein {ECO:0000250|UniProtKB:Q9ESF1}. Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q9ESF1}; Single-pass type II membrane protein {ECO:0000250|UniProtKB:Q9ESF1}. Golgi apparatus membrane {ECO:0000250|UniProtKB:Q9ESF1}; Single-pass type II membrane protein {ECO:0000250|UniProtKB:Q9ESF1}. Presynaptic cell membrane {ECO:0000250|UniProtKB:Q9ESF1}; Single-pass type II membrane protein {ECO:0000250|UniProtKB:Q9ESF1}. Cell membrane {ECO:0000250|UniProtKB:Q9ESF1}; Single-pass type II membrane protein {ECO:0000250|UniProtKB:Q9ESF1}. Note=Detected at basolateral cell membrane with synaptic vesicles surrounding the ribbon and at the presynaptic plasma membrane in the inner hair cells (IHCs) at postnatal day 30 (P30). Colocalizes with GPR25 and RAB8B in inner hair cells {ECO:0000250|UniProtKB:Q9ESF1}
Tissue Location Isoform 1 and isoform 3 are found in adult brain. Isoform 2 is expressed in the fetus and in adult brain, heart, placenta, skeletal muscle and kidney
Research Areas
Citations ( 0 )

Background

Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 280.00
Cat# ABO12302
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"