Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   Anti-Munc18-1 Picoband Antibody   

Anti-Munc18-1 Picoband Antibody

     
  • WB - Anti-Munc18-1 Picoband Antibody ABO12505
    Anti- Munc18-1 Picoband antibody, ABO12505, Western blottingAll lanes: Anti Munc18-1 (ABO12505) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: PANC Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugPredicted bind size: 67KDObserved bind size: 67KD
    detail
  • IHC - Anti-Munc18-1 Picoband Antibody ABO12505
    Anti- Munc18-1 Picoband antibody, ABO12505, IHC(P)IHC(P): Mouse Brain Tissue
    detail
  • IHC - Anti-Munc18-1 Picoband Antibody ABO12505
    Anti- Munc18-1 Picoband antibody, ABO12505, IHC(P)IHC(P): Rat Brain Tissue
    detail
  • IHC - Anti-Munc18-1 Picoband Antibody ABO12505
    Anti- Munc18-1 Picoband antibody, ABO12505, IHC(P)IHC(P): Human Glioma Tissue
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession P61764
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 6812
Other Names Syntaxin-binding protein 1, MUNC18-1, N-Sec1, Protein unc-18 homolog 1, Unc18-1, Protein unc-18 homolog A, Unc-18A, p67, STXBP1, UNC18A
Calculated MW 67569 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat
Subcellular Localization Cytoplasm, cytosol . Membrane; Peripheral membrane protein.
Tissue Specificity Brain and spinal cord. Highly enriched in axons.
Protein Name Syntaxin-binding protein 1
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name STXBP1
Synonyms UNC18A
Function Participates in the regulation of synaptic vesicle docking and fusion through interaction with GTP-binding proteins (By similarity). Essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. Can interact with syntaxins 1, 2, and 3 but not syntaxin 4. Involved in the release of neurotransmitters from neurons through interacting with SNARE complex component STX1A and mediating the assembly of the SNARE complex at synaptic membranes (By similarity). May play a role in determining the specificity of intracellular fusion reactions.
Cellular Location Cytoplasm, cytosol. Membrane; Peripheral membrane protein
Tissue Location Brain and spinal cord. Highly enriched in axons.
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 280.00
Cat# ABO12505
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"