Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Anti-UPF3B/RENT3B Picoband Antibody   

Anti-UPF3B/RENT3B Picoband Antibody

     
  • WB - Anti-UPF3B/RENT3B Picoband Antibody ABO12529
    Anti- UPF3B/RENT3B Picoband antibody, ABO12529, Western blottingAll lanes: Anti UPF3B/RENT3B (ABO12529) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: 22RV1 Whole Cell Lysate at 40ugLane 5: U87 Whole Cell Lysate at 40ugLane 6: JURKAT Whole Cell Lysate at 40ugPredicted bind size: 58KDObserved bind size: 58KD
    detail
  • IHC - Anti-UPF3B/RENT3B Picoband Antibody ABO12529
    Anti- UPF3B/RENT3B Picoband antibody, ABO12529, IHC(P)IHC(P): Mouse Testis Tissue
    detail
  • IHC - Anti-UPF3B/RENT3B Picoband Antibody ABO12529
    Anti- UPF3B/RENT3B Picoband antibody, ABO12529, IHC(P)IHC(P): Rat Testis Tissue
    detail
  • IHC - Anti-UPF3B/RENT3B Picoband Antibody ABO12529
    Anti- UPF3B/RENT3B Picoband antibody, ABO12529, IHC(P)IHC(P): Human Placenta Tissue
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession Q9BZI7
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 3B(UPF3B) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 65109
Other Names Regulator of nonsense transcripts 3B, Nonsense mRNA reducing factor 3B, Up-frameshift suppressor 3 homolog B, hUpf3B, Up-frameshift suppressor 3 homolog on chromosome X, hUpf3p-X, UPF3B, RENT3B, UPF3X
Calculated MW 57762 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human, Rat
Subcellular Localization Nucleus. Cytoplasm. Shuttling between the nucleus and the cytoplasm.
Tissue Specificity Expressed in testis, uterus, prostate, heart, muscle, brain, spinal cord and placenta. .
Protein Name Regulator of nonsense transcripts 3B
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human UPF3B /RENT3B (416-452aa SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL).
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name UPF3B (HGNC:20439)
Function Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC) and serving as link between the EJC core and NMD machinery. Recruits UPF2 at the cytoplasmic side of the nuclear envelope and the subsequent formation of an UPF1-UPF2-UPF3 surveillance complex (including UPF1 bound to release factors at the stalled ribosome) is believed to activate NMD. In cooperation with UPF2 stimulates both ATPase and RNA helicase activities of UPF1. Binds spliced mRNA upstream of exon-exon junctions. In vitro, stimulates translation; the function is independent of association with UPF2 and components of the EJC core.
Cellular Location Nucleus. Cytoplasm Note=Shuttling between the nucleus and the cytoplasm
Tissue Location Expressed in testis, uterus, prostate, heart, muscle, brain, spinal cord and placenta.
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

Regulator of nonsense transcripts 3B is a protein that in humans is encoded by the UPF3B gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 280.00
Cat# ABO12529
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"