Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Anti-BCAR3 Picoband Antibody   

Anti-BCAR3 Picoband Antibody

     
  • WB - Anti-BCAR3 Picoband Antibody ABO12532
    Western blot analysis of BCAR3 expression in HEPG2 whole cell lysates (lane 1). BCAR3 at 93KD was detected using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody(Catalog # ABO12532) at 0.5 ??g/mL. The blot was developed using chemiluminescence (ECL) method .
  • IHC - Anti-BCAR3 Picoband Antibody ABO12532
    BCAR3 was detected in paraffin-embedded sections of mouse lymphaden tissues using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody (Catalog # ABO12532) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
  • IHC - Anti-BCAR3 Picoband Antibody ABO12532
    BCAR3 was detected in paraffin-embedded sections of rat spleen tissues using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody (Catalog # ABO12532) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
  • IHC - Anti-BCAR3 Picoband Antibody ABO12532
    BCAR3 was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody (Catalog # ABO12532) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P
Primary Accession O75815
Host Rabbit
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Breast cancer anti-estrogen resistance protein 3(BCAR3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Other Names Breast cancer anti-estrogen resistance protein 3, Novel SH2-containing protein 2, SH2 domain-containing protein 3B, BCAR3, NSP2, SH2D3B
Calculated MW 92566 MW KDa
Application Details Immunohistochemistry(Paraffin-embedded Section), 0.5-1 µg/ml, Human, Mouse, Rat, By Heat

Western blot, 0.1-0.5 µg/ml, Human
Tissue Specificity Ubiquitously expressed. Found in several cancer cell lines, but not in nonmalignant breast tissue. .
Protein Name Breast cancer anti-estrogen resistance protein 3
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL), different from the related mouse sequence by five amino acids.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins.
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name BCAR3
Synonyms NSP2, SH2D3B
Function May act as an adapter protein and couple activated growth factor receptors to a signaling pathway that regulates the proliferation in breast cancer cells. When overexpressed, it confers anti-estrogen resistance in breast cancer cell lines. May also be regulated by cellular adhesion to extracellular matrix proteins.
Tissue Location Ubiquitously expressed. Found in several cancer cell lines, but not in nonmalignant breast tissue EMBL; U92715; AAC39777.1; -; mRNA EMBL; AF124250; AAD28245.1; -; mRNA EMBL; AY358996; AAQ89355.1; -; mRNA EMBL; AL833121; -; NOT_ANNOTATED_CDS; mRNA EMBL; AL049796; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL109613; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL359820; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL512488; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471097; EAW73065.1; -; Genomic_DNA EMBL; CH471097; EAW73066.1; -; Genomic_DNA EMBL; CH471097; EAW73068.1; -; Genomic_DNA EMBL; BC039895; AAH39895.1; -; mRNA CCDS; CCDS58010.1; -. [O75815-3] CCDS; CCDS745.1; -. [O75815-1] CCDS; CCDS76181.1; -. [O75815-2] RefSeq; NP_001248337.1; NM_001261408.1. [O75815-1] RefSeq; NP_001248338.1; NM_001261409.1. [O75815-1] RefSeq; NP_001248339.1; NM_001261410.1. [O75815-3] RefSeq; NP_001295180.1; NM_001308251.1. [O75815-2] RefSeq; NP_003558.1; NM_003567.3. [O75815-1] RefSeq; XP_016857969.1; XM_017002480.1. [O75815-1] UniGene; Hs.36958; - PDB; 3T6A; X-ray; 2.40 A; A/B/C/D=502-825 PDBsum; 3T6A; - ProteinModelPortal; O75815; - SMR; O75815; - BioGrid; 114000; 38 DIP; DIP-33857N; - IntAct; O75815; 77 MINT; O75815; - STRING; 9606.ENSP00000260502; - iPTMnet; O75815; - PhosphoSitePlus; O75815; - BioMuta; BCAR3; - EPD; O75815; - MaxQB; O75815; - PaxDb; O75815; - PeptideAtlas; O75815; - PRIDE; O75815; - ProteomicsDB; 50205; - ProteomicsDB; 50206; -. [O75815-2] DNASU; 8412; - Ensembl; ENST00000260502; ENSP00000260502; ENSG00000137936. [O75815-1] Ensembl; ENST00000370243; ENSP00000359263; ENSG00000137936. [O75815-1] Ensembl; ENST00000370244; ENSP00000359264; ENSG00000137936. [O75815-1] Ensembl; ENST00000370247; ENSP00000359267; ENSG00000137936. [O75815-3] Ensembl; ENST00000539242; ENSP00000441343; ENSG00000137936. [O75815-2] GeneID; 8412; - KEGG; hsa:8412; - UCSC; uc001dpx.6; human. [O75815-1] CTD; 8412; - DisGeNET; 8412; - EuPathDB; HostDB:ENSG00000137936.16; - GeneCards; BCAR3; - HGNC; HGNC:973; BCAR3 HPA; HPA014858; - MIM; 604704; gene neXtProt; NX_O75815; - OpenTargets; ENSG00000137936; - PharmGKB; PA25283; - eggNOG; ENOG410IFQG; Eukaryota eggNOG; ENOG410XTJR; LUCA GeneTree; ENSGT00390000008976; - HOGENOM; HOG000231595; - HOVERGEN; HBG053174; - InParanoid; O75815; - OMA; NYCELNP; - OrthoDB; EOG091G01KG; - PhylomeDB; O75815; - TreeFam; TF323756; - SignaLink; O75815; - ChiTaRS; BCAR3; human GeneWiki; BCAR3; - GenomeRNAi; 8412; - PRO; PR:O75815; - Proteomes; UP000005640; Chromosome 1 Bgee; ENSG00000137936; - CleanEx; HS_BCAR3; - Genevisible; O75815; HS GO; GO:0005622; C:intracellular; IEA:GOC GO; GO:0005085; F:guanyl-nucleotide exchange factor activity; IEA:UniProtKB-KW GO; GO:0005070; F:SH3/SH2 adaptor activity; IBA:GO_Central GO; GO:0002089; P:lens morphogenesis in camera-type eye; IEA:Ensembl GO; GO:0033138; P:positive regulation of peptidyl-serine phosphorylation; IEA:Ensembl GO; GO:0042493; P:response to drug; TAS:ProtInc GO; GO:0007165; P:signal transduction; TAS:ProtInc GO; GO:0007264; P:small GTPase mediated signal transduction; IEA:InterPro CDD; cd00155; RasGEF; 1 Gene3D; 1.10.840.10; -; 1 Gene3D; 3.30.505.10; -; 1 InterPro; IPR028849; BCAR3 InterPro; IPR023578; Ras_GEF_dom_sf InterPro; IPR001895; RASGEF_cat_dom InterPro; IPR036964; RASGEF_cat_dom_sf InterPro; IPR000980; SH2 InterPro; IPR036860; SH2_dom_sf PANTHER; PTHR14247:SF10; PTHR14247:SF10; 1 Pfam; PF00617; RasGEF; 1 Pfam; PF00017; SH2; 1 SMART; SM00147; RasGEF; 1 SMART; SM00252; SH2; 1 SUPFAM; SSF48366; SSF48366; 1 SUPFAM; SSF55550; SSF55550; 1 PROSITE; PS50009; RASGEF_CAT; 1 PROSITE; PS50001; SH2; 1 1: Evidence at protein level; 3D-structure; Acetylation; Alternative splicing; Complete proteome; Guanine-nucleotide releasing factor; Methylation; Phosphoprotein; Polymorphism; Reference proteome; SH2 domain INIT_MET 1 1 Removed. CHAIN 2 825 Breast cancer anti-estrogen resistance protein 3 /FTId=PRO_0000230284 DOMAIN 154 253 SH2. {ECO:0000255|PROSITE- ProRule:PRU00191} DOMAIN 548 818 Ras-GEF. {ECO:0000255|PROSITE- ProRule:PRU00168} COMPBIAS 479 482 Poly-Asp MOD_RES 2 2 N-acetylalanine MOD_RES 32 32 Phosphoserine MOD_RES 78 78 Phosphoserine MOD_RES 83 83 Phosphoserine MOD_RES 182 182 Phosphoserine MOD_RES 290 290 Phosphoserine MOD_RES 334 334 N6-methyllysine MOD_RES 358 358 Phosphoserine MOD_RES 363 363 Phosphoserine MOD_RES 375 375 Phosphoserine MOD_RES 442 442 Omega-N-methylarginine MOD_RES 471 471 Phosphoserine {ECO:0000250|UniProtKB:Q9QZK2} VAR_SEQ 1 324 Missing (in isoform 2) /FTId=VSP_017814 VAR_SEQ 1 91 Missing (in isoform 3) /FTId=VSP_046716 VAR_SEQ 92 117 ESPWQDRHGETFTFRDPHLLDPTVEY -> MPKECSAFHAL SAALCCFYHRKSFIG (in isoform 3) /FTId=VSP_046717 VARIANT 464 464 E -> G (in dbSNP:rs12062278) /FTId=VAR_050689 VARIANT 593 593 Q -> H (in dbSNP:rs17110107) /FTId=VAR_050690 CONFLICT 519 519 E -> G (in Ref. 4; AL833121) CONFLICT 543 543 L -> P (in Ref. 4; AL833121) HELIX 517 519 {ECO:0000244|PDB:3T6A} HELIX 534 546 {ECO:0000244|PDB:3T6A} HELIX 549 563 {ECO:0000244|PDB:3T6A} HELIX 571 577 {ECO:0000244|PDB:3T6A} STRAND 578 580 {ECO:0000244|PDB:3T6A} HELIX 582 585 {ECO:0000244|PDB:3T6A} HELIX 589 591 {ECO:0000244|PDB:3T6A} HELIX 592 614 {ECO:0000244|PDB:3T6A} HELIX 620 639 {ECO:0000244|PDB:3T6A} HELIX 644 655 {ECO:0000244|PDB:3T6A} HELIX 657 660 {ECO:0000244|PDB:3T6A} HELIX 663 672 {ECO:0000244|PDB:3T6A} HELIX 674 682 {ECO:0000244|PDB:3T6A} HELIX 684 692 {ECO:0000244|PDB:3T6A} HELIX 696 698 {ECO:0000244|PDB:3T6A} HELIX 711 717 {ECO:0000244|PDB:3T6A} HELIX 724 726 {ECO:0000244|PDB:3T6A} HELIX 732 734 {ECO:0000244|PDB:3T6A} HELIX 737 752 {ECO:0000244|PDB:3T6A} HELIX 754 764 {ECO:0000244|PDB:3T6A} TURN 765 767 {ECO:0000244|PDB:3T6A} HELIX 772 777 {ECO:0000244|PDB:3T6A} HELIX 780 792 {ECO:0000244|PDB:3T6A} HELIX 797 815 {ECO:0000244|PDB:3T6A} SEQUENCE 825 AA; 92566 MW; C55D61BB4AC7D0F2 CRC64; MAAGKFASLP RNMPVNHQFP LASSMDLLSS RSPLAEHRPD AYQDVSIHGT LPRKKKGPPP IRSCDDFSHM GTLPHSKSPR QNSPVTQDGI QESPWQDRHG ETFTFRDPHL LDPTVEYVKF SKERHIMDRT PEKLKKELEE ELLLSSEDLR SHAWYHGRIP RQVSENLVQR DGDFLVRDSL SSPGNFVLTC QWKNLAQHFK INRTVLRLSE AYSRVQYQFE MESFDSIPGL VRCYVGNRRP ISQQSGAIIF QPINRTVPLR CLEEHYGTSP GQAREGSLTK GRPDVAKRLS LTMGGVQARE QNLPRGNLLR NKEKSGSQPA CLDHMQDRRA LSLKAHQSES YLPIGCKLPP QSSGVDTSPC PNSPVFRTGS EPALSPAVVR RVSSDARAGE ALRGSDSQLC PKPPPKPCKV PFLKVPSSPS AWLNSEANYC ELNPAFATGC GRGAKLPSCA QGSHTELLTA KQNEAPGPRN SGVNYLILDD DDRERPWEPA AAQMEKGQWD KGEFVTPLLE TVSSFRPNEF ESKFLPPENK PLETAMLKRA KELFTNNDPK VIAQHVLSMD CRVARILGVS EEMRRNMGVS SGLELITLPH GHQLRLDIIE RHNTMAIGIA VDILGCTGTL EDRAATLSKI IQVAVELKDS MGDLYSFSAL MKALEMPQIT RLEKTWTALR HQYTQTAILY EKQLKPFSKL LHEGRESTCV PPNNVSVPLL MPLVTLMERQ AVTFEGTDMW EKNDQSCEIM LNHLATARFM AEAADSYRMN AERILAGFQP DEEMNEICKT EFQMRLLWGS KGAQVNQTER YEKFNQILTA LSRKLEPPPV KQAEL
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Breast cancer anti-estrogen resistance protein 3 is a protein that in humans is encoded by the BCAR3 gene. Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. Multiple transcript variants encoding different isoforms have been found for this gene.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 280.00
Cat# ABO12532
Size:
Quantity:
Availability: 3-5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions