Anti-UBA1 Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB |
---|---|
Primary Accession | P22314 |
Host | Rabbit |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for Ubiquitin-like modifier-activating enzyme 1(UBA1) detection. Tested with WB in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 7317 |
---|---|
Other Names | Ubiquitin-like modifier-activating enzyme 1, 6.2.1.45, Protein A1S9, Ubiquitin-activating enzyme E1, UBA1, A1S9T, UBE1 |
Calculated MW | 117849 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat |
Subcellular Localization | Cytoplasm . Mitochondrion . Nucleus . |
Tissue Specificity | Detected in erythrocytes (at protein level). Ubiquitous. . |
Protein Name | Ubiquitin-like modifier-activating enzyme 1 |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human UBA1 (102-139aa HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN), different from the related mouse and rat sequences by one amino acid. |
Purification | Immunogen affinity purified. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing. |
Name | UBA1 |
---|---|
Synonyms | A1S9T, UBE1 |
Function | Catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation through the ubiquitin-proteasome system (PubMed:1606621, PubMed:1447181, PubMed:33108101). Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding a ubiquitin-E1 thioester and free AMP (PubMed:1447181). Essential for the formation of radiation-induced foci, timely DNA repair and for response to replication stress. Promotes the recruitment of TP53BP1 and BRCA1 at DNA damage sites (PubMed:22456334). |
Cellular Location | Cytoplasm. Mitochondrion. Nucleus [Isoform 2]: Cytoplasm |
Tissue Location | Detected in erythrocytes (at protein level). Ubiquitous. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Ubiquitin-like modifier activating enzyme 1 (UBA1) is an enzyme which in humans is encoded by the UBA1 gene. The protein encoded by this gene catalyzes the first step in ubiquitin conjugation, or ubiquitination, to mark cellular proteins for degradation. Specifically, UBA1 catalyzes the ATP-dependent adenylation of ubiquitin (Ub), thereby forming a thioester bond between the two. It also continues to participate in subsequent steps of ubiquination as a Ub carrier. UBA1 is one of only two human ubiquitin-activating enzymes (E1), the other being UBA6, and thus is largely responsible for protein ubiquitination in humans. Through its central role in ubiquitination, UBA1 has been linked to cell cycle regulation, endocytosis, signal transduction, apoptosis, DNA damage repair, and transcriptional regulation. Additionally, UBE1 helps regulate the NEDD8 pathway, thus implicating it in protein folding, as well as mitigating the depletion of ubiquitin levels during stress.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.