Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
COVID19
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Anti-Argonaute 4 Picoband Antibody   

Anti-Argonaute 4 Picoband Antibody

     
  • WB - Anti-Argonaute 4 Picoband Antibody ABO12664
    Western blot analysis of Argonaute 4 expression in rat thymus extract (lane 1) and 22RV1 whole cell lysates (lane 2). Argonaute 4 at 115KD was detected using rabbit anti- Argonaute 4 Antigen Affinity purified polyclonal antibody (Catalog # ABO12664) at 0.5 ??g/mL. The blot was developed using chemiluminescence (ECL) method .
    detail
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
  • detail
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession Q9HCK5
Host Rabbit
Reactivity Human, Rat
Clonality Polyclonal
Format Lyophilized
Description Rabbit IgG polyclonal antibody for Protein argonaute-4(AGO4) detection. Tested with WB in Human;Rat.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Additional Information
Gene ID 192670
Other Names Protein argonaute-4 {ECO:0000255|HAMAP-Rule:MF_03033}, Argonaute4 {ECO:0000255|HAMAP-Rule:MF_03033}, hAgo4, Argonaute RISC catalytic component 4, Eukaryotic translation initiation factor 2C 4 {ECO:0000255|HAMAP-Rule:MF_03033}, eIF-2C 4 {ECO:0000255|HAMAP-Rule:MF_03033}, eIF2C 4 {ECO:0000255|HAMAP-Rule:MF_03033}, AGO4, EIF2C4, KIAA1567
Calculated MW 97097 MW KDa
Application Details Western blot, 0.1-0.5 µg/ml, Human, Rat
Subcellular Localization Cytoplasm, P-body .
Protein Name Protein argonaute-4
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence.
Purification Immunogen affinity purified.
Cross Reactivity No cross reactivity with other proteins.
Storage At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Information
Name AGO4
Synonyms EIF2C4, KIAA1567
Function Required for RNA-mediated gene silencing (RNAi). Binds to short RNAs such as microRNAs (miRNAs) and represses the translation of mRNAs which are complementary to them. Lacks endonuclease activity and does not appear to cleave target mRNAs. Also required for RNA-directed transcription and replication of the human hapatitis delta virus (HDV).
Cellular Location Cytoplasm, P-body {ECO:0000255|HAMAP- Rule:MF_03033, ECO:0000269|PubMed:16081698, ECO:0000269|PubMed:19167051}
Research Areas
Citations (0)
citation

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abcepta antibody to
info@abcepta.com, and receive a free "I Love Antibodies" mug.

Background

AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1.

FeedBack
Abcepta welcomes feedback from its customers.

If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abcepta.com.

$ 240.00
Cat# ABO12664
Size:
Quantity:
Availability: 3-5 days
Bulk Size

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abcepta, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions
"