Anti-IKK gamma Picoband Antibody
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Application
| WB |
---|---|
Primary Accession | Q9Y6K9 |
Host | Rabbit |
Isotype | Rabbit IgG |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Format | Lyophilized |
Description | Rabbit IgG polyclonal antibody for NF-kappa-B essential modulator(IKBKG) detection. Tested with WB in Human;Mouse;Rat. |
Reconstitution | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Gene ID | 8517 |
---|---|
Other Names | NF-kappa-B essential modulator, NEMO, FIP-3, IkB kinase-associated protein 1, IKKAP1, Inhibitor of nuclear factor kappa-B kinase subunit gamma, I-kappa-B kinase subunit gamma, IKK-gamma, IKKG, IkB kinase subunit gamma, NF-kappa-B essential modifier, IKBKG, FIP3, NEMO |
Calculated MW | 48198 MW KDa |
Application Details | Western blot, 0.1-0.5 µg/ml, Human, Mouse, Rat |
Subcellular Localization | Cytoplasm . Nucleus . Sumoylated NEMO accumulates in the nucleus in response to genotoxic stress. |
Tissue Specificity | Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. |
Contents | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human IKK gamma (207-246aa QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK), different from the related mouse and rat sequences by three amino acids. |
Cross Reactivity | No cross reactivity with other proteins. |
Storage | At -20˚C for one year. After r˚Constitution, at 4˚C for one month. It˚Can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing. |
Name | IKBKG (HGNC:5961) |
---|---|
Synonyms | FIP3, NEMO |
Function | Regulatory subunit of the IKK core complex which phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor (PubMed:9751060, PubMed:14695475, PubMed:20724660, PubMed:21518757). Its binding to scaffolding polyubiquitin plays a key role in IKK activation by multiple signaling receptor pathways (PubMed:16547522, PubMed:18287044, PubMed:19033441, PubMed:21606507, PubMed:27777308, PubMed:19185524, PubMed:33567255). Can recognize and bind both 'Lys-63'-linked and linear polyubiquitin upon cell stimulation, with a much higher affinity for linear polyubiquitin (PubMed:16547522, PubMed:18287044, PubMed:27777308, PubMed:19033441, PubMed:21606507, PubMed:19185524). Could be implicated in NF-kappa-B-mediated protection from cytokine toxicity. Essential for viral activation of IRF3 (PubMed:19854139). Involved in TLR3- and IFIH1-mediated antiviral innate response; this function requires 'Lys- 27'-linked polyubiquitination (PubMed:20724660). |
Cellular Location | Cytoplasm. Nucleus Note=Sumoylated NEMO accumulates in the nucleus in response to genotoxic stress. |
Tissue Location | Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.