Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   Goat Antibodies   >   Goat Anti-SCARF1 / SREC Antibody   

Goat Anti-SCARF1 / SREC Antibody

Peptide-affinity purified goat antibody

     
  • WB - Goat Anti-SCARF1 / SREC Antibody AF1963a
    AF1963a (0.3 µg/ml) staining of Human Heart lysate (35 µg protein in RIPA buffer) with (B) and without (A) blocking with the immunising peptide. Primary incubation was 1 hour. Detected by chemiluminescence.
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IF, ICC, E
Primary Accession Q14162
Other Accession NP_663327, 8578
Reactivity Human
Host Goat
Clonality Polyclonal
Concentration 100ug/200ul
Isotype IgG
Additional Information
Other Names Scavenger receptor class F member 1, Acetyl LDL receptor, Scavenger receptor expressed by endothelial cells 1, SREC-I, SCARF1, KIAA0149, SREC
Format 0.5 mg IgG/ml in Tris saline (20mM Tris pH7.3, 150mM NaCl), 0.02% sodium azide, with 0.5% bovine serum albumin
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsGoat Anti-SCARF1 / SREC Antibody is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name SCARF1
Synonyms KIAA0149, SREC
Function Mediates the binding and degradation of acetylated low density lipoprotein (Ac-LDL). Mediates heterophilic interactions, suggesting a function as adhesion protein. Plays a role in the regulation of neurite-like outgrowth (By similarity).
Cellular Location Membrane; Single-pass type I membrane protein
Tissue Location Endothelial cells. EMBL; D86864; BAA24070.1; -; mRNA EMBL; AB052946; BAC02692.1; -; Genomic_DNA EMBL; AB052947; BAC02693.1; -; mRNA EMBL; AB052948; BAC02694.1; -; mRNA EMBL; AB052949; BAC02695.1; -; mRNA EMBL; AB052950; BAC02696.1; -; mRNA EMBL; D63483; BAA09770.1; -; mRNA EMBL; AC130343; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471108; EAW90596.1; -; Genomic_DNA EMBL; BC039735; AAH39735.1; -; mRNA CCDS; CCDS11007.1; -. [Q14162-1] CCDS; CCDS45564.1; -. [Q14162-3] RefSeq; NP_003684.2; NM_003693.3. [Q14162-1] RefSeq; NP_663325.1; NM_145350.2. [Q14162-3] UniGene; Hs.647430; - ProteinModelPortal; Q14162; - SMR; Q14162; - IntAct; Q14162; 17 STRING; 9606.ENSP00000263071; - iPTMnet; Q14162; - PhosphoSitePlus; Q14162; - SwissPalm; Q14162; - DMDM; 311033530; - PaxDb; Q14162; - PeptideAtlas; Q14162; - PRIDE; Q14162; - ProteomicsDB; 59887; - ProteomicsDB; 59888; -. [Q14162-2] ProteomicsDB; 59889; -. [Q14162-3] ProteomicsDB; 59890; -. [Q14162-4] ProteomicsDB; 59891; -. [Q14162-5] Ensembl; ENST00000263071; ENSP00000263071; ENSG00000074660. [Q14162-1] Ensembl; ENST00000434376; ENSP00000411167; ENSG00000074660. [Q14162-5] Ensembl; ENST00000571272; ENSP00000458174; ENSG00000074660. [Q14162-3] Ensembl; ENST00000621348; ENSP00000481595; ENSG00000276336. [Q14162-1] Ensembl; ENST00000631462; ENSP00000487665; ENSG00000276336. [Q14162-5] Ensembl; ENST00000632317; ENSP00000488776; ENSG00000276336. [Q14162-3] GeneID; 8578; - KEGG; hsa:8578; - UCSC; uc002fsy.3; human. [Q14162-1] CTD; 8578; - EuPathDB; HostDB:ENSG00000074660.15; - GeneCards; SCARF1; - H-InvDB; HIX0013404; - HGNC; HGNC:16820; SCARF1 HPA; HPA072936; - MIM; 607873; gene neXtProt; NX_Q14162; - OpenTargets; ENSG00000074660; - PharmGKB; PA38420; - eggNOG; KOG1218; Eukaryota eggNOG; ENOG410XQWV; LUCA GeneTree; ENSGT00730000110380; - HOGENOM; HOG000015093; - HOVERGEN; HBG099941; - InParanoid; Q14162; - OMA; PHGRCDP; - OrthoDB; EOG091G03V8; - PhylomeDB; Q14162; - TreeFam; TF332598; - Reactome; R-HSA-3000484; Scavenging by Class F Receptors GenomeRNAi; 8578; - PRO; PR:Q14162; - Proteomes; UP000005640; Chromosome 17 Bgee; ENSG00000074660; - CleanEx; HS_SCARF1; - ExpressionAtlas; Q14162; baseline and differential Genevisible; Q14162; HS GO; GO:0030666; C:endocytic vesicle membrane; TAS:Reactome GO; GO:0016021; C:integral component of membrane; IDA:UniProtKB GO; GO:0005886; C:plasma membrane; TAS:Reactome GO; GO:0030169; F:low-density lipoprotein particle binding; IDA:UniProtKB GO; GO:0005044; F:scavenger receptor activity; IDA:UniProtKB GO; GO:0004888; F:transmembrane signaling receptor activity; TAS:UniProtKB GO; GO:0007155; P:cell adhesion; IEA:UniProtKB-KW GO; GO:0006707; P:cholesterol catabolic process; IC:UniProtKB GO; GO:0016358; P:dendrite development; IEA:Ensembl GO; GO:0016322; P:neuron remodeling; ISS:UniProtKB GO; GO:0048680; P:positive regulation of axon regeneration; ISS:UniProtKB GO; GO:0010976; P:positive regulation of neuron projection development; ISS:UniProtKB GO; GO:0006898; P:receptor-mediated endocytosis; TAS:UniProtKB InterPro; IPR013032; EGF-like_CS InterPro; IPR000742; EGF-like_dom InterPro; IPR009030; Growth_fac_rcpt_cys_sf InterPro; IPR002049; Laminin_EGF InterPro; IPR033329; SCARF1 PANTHER; PTHR24043:SF0; PTHR24043:SF0; 1 Pfam; PF00053; Laminin_EGF; 2 SMART; SM00181; EGF; 9 SUPFAM; SSF57184; SSF57184; 1 PROSITE; PS00022; EGF_1; 6 PROSITE; PS01186; EGF_2; 6 PROSITE; PS50026; EGF_3; 3 1: Evidence at protein level; Alternative splicing; Cell adhesion; Complete proteome; Disulfide bond; EGF-like domain; Glycoprotein; Membrane; Phosphoprotein; Polymorphism; Receptor; Reference proteome; Repeat; Signal; Transmembrane; Transmembrane helix SIGNAL 1 19 CHAIN 20 830 Scavenger receptor class F member 1 /FTId=PRO_0000007738 TOPO_DOM 20 421 Extracellular. TRANSMEM 422 442 Helical. TOPO_DOM 443 830 Cytoplasmic. DOMAIN 53 87 EGF-like 1. {ECO:0000255|PROSITE- ProRule:PRU00076} DOMAIN 95 130 EGF-like 2. {ECO:0000255|PROSITE- ProRule:PRU00076} DOMAIN 155 191 EGF-like 3. {ECO:0000255|PROSITE- ProRule:PRU00076} DOMAIN 215 249 EGF-like 4. {ECO:0000255|PROSITE- ProRule:PRU00076} DOMAIN 302 339 EGF-like 5. {ECO:0000255|PROSITE- ProRule:PRU00076} DOMAIN 351 382 EGF-like 6. {ECO:0000255|PROSITE- ProRule:PRU00076} COMPBIAS 431 438 Poly-Leu COMPBIAS 476 620 Pro/Ser-rich COMPBIAS 622 798 Gly-rich MOD_RES 589 589 Phosphoserine {ECO:0000250|UniProtKB:Q5ND28} MOD_RES 606 606 Phosphoserine CARBOHYD 289 289 N-linked (GlcNAc...) asparagine CARBOHYD 382 382 N-linked (GlcNAc...) asparagine CARBOHYD 393 393 N-linked (GlcNAc...) asparagine DISULFID 57 69 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 63 75 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 77 86 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 99 111 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 105 118 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 120 129 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 159 172 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 165 179 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 181 190 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 219 230 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 225 237 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 239 248 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 306 319 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 313 326 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 329 338 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 355 363 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 358 370 {ECO:0000255|PROSITE-ProRule:PRU00076} DISULFID 372 381 {ECO:0000255|PROSITE-ProRule:PRU00076} VAR_SEQ 330 415 Missing (in isoform 2) /FTId=VSP_039956 VAR_SEQ 338 830 Missing (in isoform 4) /FTId=VSP_039957 VAR_SEQ 338 342 CEDPC -> GPVIL (in isoform 5) /FTId=VSP_039958 VAR_SEQ 343 830 Missing (in isoform 5) /FTId=VSP_039959 VAR_SEQ 496 569 VSHHDPEVPFNHSFIEPPSAGWATDDSFSSDPESGEADEVP AYCVPPQEGMVPVAQAGSSEASLAAGAFPPPED -> ASSS RPLPAGPLMTPSHPILSLERQMRFLPTVCHPKKGWSLWPRQ GRQRPAWLQVLSRPLRTPPRHSPSRAPPA (in isoform 3). /FTId=VSP_039960 VAR_SEQ 570 830 Missing (in isoform 3) /FTId=VSP_039961 VARIANT 425 425 A -> V (in dbSNP:rs2272011) {ECO:0000269|PubMed:11978792, ECO:0000269|PubMed:15489334, ECO:0000269|PubMed:8590280, ECO:0000269|PubMed:9395444, ECO:0000269|Ref.5} /FTId=VAR_047249 VARIANT 618 618 R -> K (in dbSNP:rs35455643) /FTId=VAR_047250 VARIANT 639 639 E -> D (in dbSNP:rs3744644) /FTId=VAR_047251 VARIANT 662 662 R -> W (in dbSNP:rs8072430) /FTId=VAR_047252 VARIANT 667 667 G -> S (in dbSNP:rs4790250) /FTId=VAR_047253 VARIANT 748 748 G -> V (in dbSNP:rs3760460) /FTId=VAR_047254 CONFLICT 328 329 RC -> PG (in Ref. 2; BAC02696) SEQUENCE 830 AA; 87387 MW; 3D1CBF0D6F2BA055 CRC64; MGLGLLLPLL LLWTRGTQGS ELDPKGQHVC VASSPSAELQ CCAGWRQKDQ ECTIPICEGP DACQKDEVCV KPGLCRCKPG FFGAHCSSRC PGQYWGPDCR ESCPCHPHGQ CEPATGACQC QADRWGARCE FPCACGPHGR CDPATGVCHC EPGWWSSTCR RPCQCNTAAA RCEQATGACV CKPGWWGRRC SFRCNCHGSP CEQDSGRCAC RPGWWGPECQ QQCECVRGRC SAASGECTCP PGFRGARCEL PCPAGSHGVQ CAHSCGRCKH NEPCSPDTGS CESCEPGWNG TQCQQPCLPG TFGESCEQQC PHCRHGEACE PDTGHCQRCD PGWLGPRCED PCPTGTFGED CGSTCPTCVQ GSCDTVTGDC VCSAGYWGPS CNASCPAGFH GNNCSVPCEC PEGLCHPVSG SCQPGSGSRD TALIAGSLVP LLLLFLGLAC CACCCWAPRS DLKDRPARDG ATVSRMKLQV WGTLTSLGST LPCRSLSSHK LPWVTVSHHD PEVPFNHSFI EPPSAGWATD DSFSSDPESG EADEVPAYCV PPQEGMVPVA QAGSSEASLA AGAFPPPEDA STPFAIPRTS SLARAKRPSV SFAEGTKFAP QSRRSSGELS SPLRKPKRLS RGAQSGPEGR EAEESTGPEE AEAPESFPAA ASPGDSATGH RRPPLGGRTV AEHVEAIEGS VQESSGPVTT IYMLAGKPRG SEGPVRSVFR HFGSFQKGQA EAKVKRAIPK PPRQALNRKK GSPGLASGSV GQSPNSAPKA GLPGATGPMA VRPEEAVRGL GAGTESSRRA QEPVSGCGSP EQDPQKQAEE ERQEEPEYEN VVPISRPPEP
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

The protein encoded by this gene is a scavenger receptor that is expressed in endothelial cells and mediates the binding and degradation of acetylated low density lipoprotein (Ac-LDL). Transcription factors ZNF444/EZF-2 and SP1 are found to be responsible for the regulation of this gene. Five alternatively spliced transcript variants encoding distinct isoforms have been described.

References

The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, et al. Genome Res, 2004 Oct. PMID 15489334.
SREC-I, a type F scavenger receptor, is an endocytic receptor for calreticulin. Berwin B, et al. J Biol Chem, 2004 Dec 3. PMID 15371419.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Strausberg RL, et al. Proc Natl Acad Sci U S A, 2002 Dec 24. PMID 12477932.
SREC-II, a new member of the scavenger receptor type F family, trans-interacts with SREC-I through its extracellular domain. Ishii J, et al. J Biol Chem, 2002 Oct 18. PMID 12154095.
Characterization of the human gene encoding the scavenger receptor expressed by endothelial cell and its regulation by a novel transcription factor, endothelial zinc finger protein-2. Adachi H, et al. J Biol Chem, 2002 Jul 5. PMID 11978792.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 335.00
Cat# AF1963a
Size:
Quantity:
Availability: 7-10 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions