Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Chapsyn 110 Antibody   

Chapsyn 110 Antibody

Affinity purified polyclonal antibody

  • WB - Chapsyn 110 Antibody AG1052-050
    Western blot analysis of rat brain membranes:
    1. Anti-Chapsyn 110 antibody (#AG1052), (1:1000).
    2. Anti-Chapsyn 110 antibody, preincubated with the control fusion protein antigen.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q63622
Reactivity Rat
Host Rabbit
Clonality Polyclonal
Calculated MW 94934 Da
Homology Human - 42/44 amino acidresidues identical.
Additional Information
Gene ID 64053
Other Names Disks large homolog 2, Channel-associated protein of synapse-110, Chapsyn-110, Postsynaptic density protein PSD-93, Dlg2, Dlgh2
Related products for control experimentsControl peptide antigen (supplied with the antibody free of charge).
Target/Specificity GST fusion protein with a sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat chapsyn-110. (Accession Q63622).ֲ ֲ Between PDZ2 and PDZ3 domains.
Dilution WB~~1:200-1:2000
Peptide Confirmation Confirmed by DNA sequence and SDS-PAGE.
Format Affinity purified antibody, lyophilized powder
Reconstitution 50 µl or 0.2 ml deionized water, depending on the sample size.
Antibody Concentration After Reconstitution 1 mg/ml.
Buffer After Reconstitution Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage After ReconstitutionThe reconstituted solution can be stored at 4ºC for up to 2 weeks. For longer periods, small aliquots should be stored at -20ºC or below. Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).
Control Antigen Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control Antigen Reconstitution 100 µl PBS.
Control Antigen Storage After Reconstitution-20ºC.
Preadsorption Control 1 µg fusion protein per 1 µg antibody.
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Chapsyn 110 (also known as PSD93 and DLG2) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins1,2. PDZ domains are conserved protein domains of about 90 amino acids involved in protein–protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs Large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity)1,2. MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain1,2. The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes. Indeed, Chapsyn 110 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity1,2. Abgent is pleased to offer a highly specific antibody directed against an epitope located between PDZ domains two and three of rat Chapsyn 110. Anti-Chapsyn 110 antibody (#AG1052) can be used in Western blot and immunohistochemical applications, and has been designed to recognize Chapsyn 110 from rat, mouse and human samples.


References 1. Harris, B.Z. and Lim, W.A. (2001) J. Cell Sci. 114, 3219. 2. Hung, A.Y. and Sheng, M. (2002) J. Biol. Chem. 277, 5699.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 367.00
$ 475.00
Cat# AG1052-050
Availability: 2-3 weeks
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
30% off on 2,800+ Neuroscience Antibodies. PromoCode:<span class=text-red> FLASH20
Terms & Conditions