Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Neuroscience   >   hKV11.1 (HERG) Antibody   

hKV11.1 (HERG) Antibody

Affinity purified polyclonal antibody

  • WB - hKV11.1 (HERG) Antibody AG1114-025
    Western blot analysis of Kv11.1 expressing HEK-293 cells:
    1. Anti-hKv11.1 (HERG) antibody (#AG1114), (1:400).
    2. Anti-hKv11.1 (HERG) antibody, preincubated with the control peptide antigen.
  • IP - hKV11.1 (HERG) Antibody AG1114-025
    Immunoprecipitation of Kv11.1 expressing HEK-293 cells:
    1. Cell lysate.
    2. Lysate + protein A beads + Anti- hKv11.1 (HERG) antibody (#AG1114).
    3. Cell lysate + protein A beads + Anti-Kv11.1 (erg1) antibody (#APC-016).
    4. Cell lysate + protein A beads + Anti-Kv11.1 (HERG) (extracellular) antibody (#APC-109).
    5. Cell lysate + protein A beads + pre-immune rabbit serum.

    Red arrow indicates Kv11.1 while the black arrow shows the IgG heavy chain.
    Immunoblot was performed with the Anti- hKv11.1 (HERG) antibody.
  • ICC - hKV11.1 (HERG) Antibody AG1114-025
    Expression of Kv11.1 in HEK-293 transfected cells  Immunocytochemical staining of fixed and permeabilized Kv11.1 transfected HEK-293 cells.  Cells were stained with Anti-hKv11.1 (HERG) antibody (#AG1114), followed by goat anti-rabbit-AlexaFluor-555 secondary antibody (Red). Almost all transfected cells are stained positive for the Kv11.1. Arrows indicate cells that do not express the channel.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q12809
Reactivity Human, Mouse, Rat
Host Rabbit
Clonality Polyclonal
Calculated MW 126655 Da
Homology Rabbit - identical; dog - 51/54 amino acid residues identical;mouse, rat - 50/54 amino acid residues identical.
Additional Information
Gene ID 3757
Other Names Potassium voltage-gated channel subfamily H member 2, Eag homolog, Ether-a-go-go-related gene potassium channel 1, ERG-1, Eag-related protein 1, Ether-a-go-go-related protein 1, H-ERG, hERG-1, hERG1, Voltage-gated potassium channel subunit Kv111, KCNH2, ERG, ERG1, HERG
Related products for control experimentsControl peptide antigen (supplied with the antibody free of charge).
Target/Specificity GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of humanֲ Kv11.1 (HERG) (Accession Q12809), (MW: 35 kDa.). Intracellular, C-terminus.The antibody recognizes the HERG1b splice variant but not splice variants HERG1-3 and HERG-4
Dilution WB~~1:200-1:2000
Peptide Confirmation Confirmed by DNA sequence and SDS-PAGE.
Application Details Western blot analysis (WB): - HEK 293 cells transfected with hERG (see Varkevisser, R. et al. (2013) in Product Citations). - Neonatal rat ventricular myocytes (NRVMs) (see Dennis, A.T. et al. (2011) in Product Citations). Immunoprecipitation (IP): - HeLa cells transfected with hERG (see Apaja, P.M. et al. (2013) in Product Citations). Immunohistochemistry (IH): - Mouse frozen heart sections (1:300) (see Teng, G.Q. et al. (2008) in Product Citations). Immunocytochemistry (IC): - HEK 293 cells transfected with hERG (see Varkevisser, R. et al. (2013) in Product Citations).
Format Affinity purified antibody, lyophilized powder
Reconstitution 50 µl or 0.2 ml deionized water, depending on the sample size.
Antibody Concentration After Reconstitution 0.6 mg/ml.
Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage After ReconstitutionThe reconstituted solution can be stored at 4ºC for up to 2 weeks. For longer periods, small aliquots should be stored at -20ºC or below. Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).
Control Antigen Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control Antigen Reconstitution 100 µl PBS.
Control Antigen Storage After Reconstitution-20ºC.
Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Formulation Lyophilized powder. Phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 0.025% NaN3.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.

The KV11.1 (HERG) channel is a member of the ether-a-go-go (EAG) subfamily of voltage-dependent K+ channels that includes the related proteins KV11.2 and KV11.3 (erg2 and erg3). KV11.1 possess the signature structure of the voltage-dependent K+ channels: six membrane-spanning domains and intracellular N and C termini. The KV11.1 current is characterized by strong inward rectification with slow activation and very rapid inactivation kinetics. The channel is expressed in the brain and heart (where it underlies the IKr current) and has a central role in mediating repolarization of action potentials.1,2 Mutations in the KV11.1 channel cause inherited long QT syndrome (LQTS) or abnormalities in the repolarization of the heart that are associated with life-threatening arrhythmias and sudden death. All the identified KV11.1 mutations produce loss of function of the channel via several cellular mechanisms ranging from alterations of gating properties, alterations of channel permeability/selectivity and alterations in intracellular channel trafficking that decreases the number of channels that reach the cell membrane.1,2  Lately drug-induced forms of LQTS have been reported for a wide range of non-cardiac drugs including antihistamines, psychoactive agents and antimicrobials. All these drugs potently block the KV11.1 channel as an unintended side effect, prompting regulatory drug agencies to issue recommendations for the testing of new drugs for their potential KV11.1 blocking effect.   In addition, KV11.1 expression was found to be upregulated in several tumor cell lines of different histogenesis suggesting that it confers the cells some advantage in cell proliferation. Indeed, in several studies it has been shown that inhibition of the KV11.1 current leads to a decrease in tumor cell proliferation.3   Several toxins from scorpion venoms are potent blockers (affecting the channels in the nanomolar range) of KV11.1channels. Among these the most potent and selective are Ergtoxin-1 (#RTE-450), (16 nM)4 and BeKM-1 (#RTB-470), (3 nM).5 In addition, the methanesulfonanilide class III antiarrhythmic agent E-4031 (#E-500), also blocks KV11.1 channel in the nanomolar range (7.7 nM).6

References 1. Curran, M.E. et al. (1995) Cell 80, 795 2. Sanguinetti, M.C. et al. (1995) Cell 81, 299. 3. Pardo, L.A. et al. (2004) Physiology 19, 285. 4. Gurrola, G.B. et al. (1999) FASEB. J. 13, 953. 5. Korolkova, Y.V. et al. (2001) J. Biol. Chem. 276, 9868. 6. Zhou, Z. et al. (1998) Biophys.J. 74, 230.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 375.00
$ 475.00
$ 575.00
Cat# AG1114-025
(40 western blots)
Availability: 2-3 weeks
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Santa Cruz Alternative
Terms & Conditions