Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   KCa1.1 (1097-1196) Antibody   

KCa1.1 (1097-1196) Antibody

Affinity purified polyclonal antibody

  • WB - KCa1.1 (1097-1196) Antibody AG1142-025
    Western blot analysis of rat brain membranes: 1. Anti-KCa1.1 (1097-1196) antibody (#AG1142), (1:200).
    2. Anti-KCa1.1 (1097-1196) antibody, preincubated with the control antigen.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q08460-2
Reactivity Mouse, Rat
Host Rabbit
Clonality Polyclonal
Homology Chicken - 91/99 amino acid residues identical; rabbit - 88/99 amino acid residues identical;turtle - 87/99 amino acid residues identical.
Additional Information
Gene ID 16531
Other Names BKCa; KCNMA1; SLO
Related products for control experimentsControl peptide antigen (supplied with the antibody free of charge).
Target/Specificity GST fusion protein with the sequence SHSSHSSQ SSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMG QAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIP PIREVEDEC, corresponding to residues 1097-1196 of mouse KCa1.1 variant 2 (Accession Q08460-2). Intracellular, C-terminus.
Dilution WB~~1:200-1:2000
Peptide Confirmation Confirmed by DNA sequence and SDS-PAGE.
Application Details Western blot analysis (WB): - Rat mesenteric arteries (1:300) (see Shi, L.1 et al. (2013) in Product Citations). Immunoprecipitation (IP): - Rat brain lysates (2 μg) (see Park, S.M. et al. (2004) in Product Citations). Immunohistochemistry (IH): - Rat mesenteric arteries (1:200) (see Shi, L. et al. (2013) in Product Citations). - Mouse vomeronasal sections (see Zhang, P. et al. (2008) in Product Citations). Immunocytochemistry (IC): - Mouse vomeronasal neurons (see Zhang, P. et al. (2008) in Product Citations),
Format Affinity purified antibody, lyophilized powder
Reconstitution 50 µl or 0.2 ml deionized water, depending on the sample size.
Antibody Concentration After Reconstitution 0.4 mg/ml.
Buffer After Reconstitution Phosphate buffered saline (PBS) pH 7.4, 1% BSA, 0.025% NaN3.
Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage After ReconstitutionThe reconstituted solution can be stored at 4ºC for up to 2 weeks. For longer periods, small aliquots should be stored at -20ºC or below. Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).
Control Antigen Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control Antigen Reconstitution 100 µl PBS.
Control Antigen Storage After Reconstitution-20ºC.
Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Formulation Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS) pH 7.4, 1% BSA, 0.025% NaN3.
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


The KCa1.1 channel (also known as BKCa, Maxi K+ or slo) is part of a structurally diverse group of K+ channels that are activated by an increase in intracellular Ca2+. KCa1.1 shows a large single channel conductance when recorded electrophysiologically and hence its name. It differs from the rest of the subfamily members in that it can be activated by both an increase in intracellular Ca2+ and by membrane depolarization.  In addition, the KCa1.1 channel structurally differs from the other Ca2+-dependent K+ channels. While the latter group has a topology that resembles that of the voltage-dependent K+ channels, the KCa1.1 channel has an extracellular N-terminus domain as well as an additional transmembrane domain.   KCa1.1 is expressed in virtually all cell types where it causes hyperpolarization and helps to connect between intracellular Ca2+ signaling pathways and membrane excitability.   Indeed, KCa1.1 channels play a crucial role in smooth muscle contractility, neuronal spike shaping and neurotransmitter release.


References 1. Wallner, M. et al. (1999) Proc. Natl. Acad. Sci. U.S.A. 96, 4137. 2. Xia, X.M. et al. (1999) J. Neurosci. 19, 5255. 3. Orio, P. et al. (2002) News Physiol. Sci. 17, 156.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 375.00
$ 475.00
$ 575.00
Cat# AG1142-025
Availability: 2-3 weeks
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Crown Flash17-30% Off
Terms & Conditions