Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   KV1.2 Antibody   

KV1.2 Antibody

Affinity purified polyclonal antibody

  • WB - KV1.2 Antibody AG1149-025
    Western blot analysis of rat brain membranes:
    1. Anti-KV1.2 antibody (#AG1149), (1:200).
    2. Anti-KV1.2 antibody, preincubated with the control peptide antigen.
  • WB - KV1.2 Antibody AG1149-025
    Western blot analysis of rat heart membranes:
    1. Anti-KV1.2 antibody (#AG1149), (1:200)
    2. Anti-KV1.2 antibody, preincubated with the control antigen.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P63142
Reactivity Human, Mouse, Rat
Host Rabbit
Clonality Polyclonal
Calculated MW 56701 Da
Homology Mouse, dog, human, - identical.
Additional Information
Gene ID 25468
Other Names Potassium voltage-gated channel subfamily A member 2, RAK, RBK2, RCK5, Voltage-gated potassium channel subunit Kv12, Kcna2
Related products for control experimentsControl peptide antigen (supplied with the antibody free of charge).
Target/Specificity GST fusion protein with sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142).ֲ ֲ Intracellular, C-terminus.
Dilution WB~~1:200-1:2000
Peptide Confirmation Confirmed by DNA sequence and SDS-PAGE.
Application Details Western blot analysis (WB): - Mouse spinal cord lysate (1:1000) (see Zoupi, L. et al. (2013) in Product Citations). - Rat lung lysate (see Lv, Y. et al. (2013) in Product Citations). Immunohistochemistry (IH): - Mouse spinal cord and cortex sections (1:200) (see Zoupi, L. et al. (2013) in Product Citations). - Mouse cerebellum (1:300) (see Kleopa, K.A. et al. (2006) in Product Citations). Immunocytochemistry (IC): - HeLa transfected cells (1:200) (see Kleopa, K.A. et al. (2006) in Product Citations).
Format Affinity purified antibody, lyophilized powder
Reconstitution 50 µl or 0.2 ml deionized water, depending on the sample size.
Antibody Concentration After Reconstitution 0.8 mg/ml.
Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage After ReconstitutionThe reconstituted solution can be stored at 4ºC for up to 2 weeks. For longer periods, small aliquots should be stored at -20ºC or below. Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).
Control Antigen Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control Antigen Reconstitution 100 µl PBS.
Control Antigen Storage After Reconstitution-20ºC.
Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Formulation Lyophilized powder. Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


KV1.2 is a mammalian voltage dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.2 was first cloned from rat brain.1 Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes.2 A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function. The structure of KV1.2 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. 2 The channel is expressed in neurons and cardiac and smooth muscle tissue as well as in retina and pancreas.2 The crystal structure of KV1.2 was recently solved shading light on the structure of a mammalian voltage dependent channel.3 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle. KV1.2 channels are sensitive to high doses of TEA (560 mM) and low doses of 4-AP (0.59 mM), the “classical” non-selective potassium channel blockers. Several venomous toxins from SnakesScorpions and Honey Bee are potent blockers (affecting the channels in the nanomolar range) of KV1.2 channels. Among these the most potent and selective are α-Dendrotoxin (#D-350, 1-12 nM), Dendrotoxin-I (#D-390, 0.13 nM), Maurotoxin (STM-340, 0.1-0.8 nM), Hongotoxin-1 (#RTH-400, 0.17 nM), Margatoxin (#RTM-325, 0.16-0.65 nM), Tityustoxin Kα (#STT-360, 0.21 nM) and MCD peptide (STM-250, 10-400 nM).4


References 1. McKinnon, D. (1989) J.Biol. Chem. 264, 8230. 2. Gutman, G.A. et al. (2005) Pharmacol. Rev. 57, 473. 3. Long, S.B. et al. (2005) Science 309, 897. 4. Bogin, O. (2006) Modulator 21, 28.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 375.00
$ 475.00
$ 575.00
Cat# AG1149-025
Availability: 2-3 weeks
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Crown Flash17-30% Off
Terms & Conditions