Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   KV1.6 Antibody   

KV1.6 Antibody

Affinity purified polyclonal antibody

  • WB - KV1.6 Antibody AG1153-050
    Western blot analysis of rat brain membranes:
    1. Anti-Kv1.6 antibody (#AG1153), (1:200).
    2. Anti-Kv1.6 antibody, preincubated with the control peptide antigen.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P17659
Reactivity Mouse, Rat
Host Rabbit
Clonality Polyclonal
Calculated MW 58884 Da
Homology Mouse - 67/68 amino acid residues identical; human - 63/68 amino acid residues identical.
Additional Information
Gene ID 64358
Other Names Potassium voltage-gated channel subfamily A member 6, RCK2, Voltage-gated potassium channel subunit Kv16, Voltage-gated potassium channel subunit Kv2, Kcna6
Related products for control experimentsControl peptide antigen (supplied with the antibody free of charge).
Target/Specificity GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat Kv1.6 (Accession P17659), (MW: 35 kDa.). Intracellular, C-terminus.
Dilution WB~~1:200-1:2000
Format Affinity purified antibody, lyophilized powder
Reconstitution 50 µl or 0.2 ml deionized water, depending on the sample size.
Antibody Concentration After Reconstitution 0.3 mg/ml.
Buffer After Reconstitution phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage After ReconstitutionThe reconstituted solution can be stored at 4ºC for up to 2 weeks. For longer periods, small aliquots should be stored at -20ºC or below. Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).
Control Antigen Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control Antigen Reconstitution 100 µl PBS.
Control Antigen Storage After Reconstitution-20ºC.
Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


KV1.6 is a mammalian voltage dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.6 was first cloned from human brain.1 Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes.2 A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function. The structure of KV1.6 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. 2 The channel is expressed in neurons and other supporting cells in the brain, in cardiac and smooth muscle tissue as well as in ovary and testis2 and its activity influences the membrane potential and excitability of expressing cells.   KV1.6 channels are sensitive to low doses of TEA (7 mM) and high doses of 4-AP (1.5 mM), the “classical” non-selective potassium channel blockers.   Several toxins from snakes, scorpions and sea anemones venoms are potent blockers (affecting the channels in the nanomolar range) of KV1.6 channels. Among these the most potent and selective are α-Dendrotoxin (#D-350), (9-25 nM) and δ-Dendrotoxin (#D-380), (23 nM), Agitoxin-2 (#RTA-420), (0.036 nM)  Hongotoxin-1 (#RTH-400), (6 nM), Margatoxin (#RTM-325), (5 nM) and Stichodactyla Toxin (#RTS-400), (0.16 mM).3 Abgent  is pleased to offer a highly specific antibody directed against an epitope of rat Kv1.6. Anti-Kv1.6 antibody (#AG1153) can be used in western blot, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize KV1.6 from human, rat and mouse samples.


References 1. Grupe, A. et al. (1990) EMBO J. 9, 1749. 2. Gutman, G. A. et al. (2005) Pharmacol. Rev. 57, 473. 3. Bogin, O (2006) Modulator 21, 28.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 475.00
$ 575.00
Cat# AG1153-050
(40 western blots)
Availability: 2-3 weeks
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609

Other Products

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Santa Cruz Alternative
Terms & Conditions