Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   KV1.3 Antibody   

KV1.3 Antibody

Affinity purified polyclonal antibody

  • WB - KV1.3 Antibody AG1154-025
    Western blot analysis of rat brain membranes:
    1. Anti-Kv1.3 antibody (#AG1154), (1:200)
    2. Anti-Kv1.3 antibody, preincubated with the control peptide antigen.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P22001
Reactivity Human, Mouse, Rat
Host Rabbit
Clonality Polyclonal
Calculated MW 63842 Da
Homology Rat, rabbit, mouse - identical.
Additional Information
Gene ID 3738
Other Names Potassium voltage-gated channel subfamily A member 3, HGK5, HLK3, HPCN3, Voltage-gated K(+) channel HuKIII, Voltage-gated potassium channel subunit Kv13, KCNA3, HGK5
Related products for control experimentsControl peptide antigen (supplied with the antibody free of charge).
Target/Specificity GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3 (Accession P22001). Intracellular, C-terminus.
Dilution WB~~1:200-1:2000
Peptide Confirmation Confirmed by DNA sequence and SDS-PAGE.
Application Details Western blot analysis (WB): - Mouse activated macrophages (BMDM cells) (see Moreno, C. et al. (2013) in Product Citations). - Human CD3+ cells (see Szigligeti, P. et al. (2006) in Product Citations). Immunoprecipitation (IP): - Transfected HEK-293 cell lysate (see Vicente, R. et al. (2006) in Product Citations). Immunocytochemistry (IC): - Human peripheral blood mononuclear cells (PBMCs) (see Hu, L. et al. (2013) in Product Citations). - Rat neural progenitor cells (NPCs) (1:200) (see Liebau, S. et al. (2006) in Product Citations).
Format Affinity purified antibody, lyophilized powder
Reconstitution 50 µl or 0.2 ml deionized water, depending on the sample size.
Antibody Concentration After Reconstitution 0.6 mg/ml.
Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage After ReconstitutionThe reconstituted solution can be stored at 4ºC for up to 2 weeks. For longer periods, small aliquots should be stored at -20ºC or below. Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).
Control Antigen Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control Antigen Reconstitution 100 µl PBS.
Control Antigen Storage After Reconstitution-20ºC.
Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Formulation Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


KV1.3 belongs to the Shaker family of voltage-dependent K+ channels. The channel is widely expressed in the brain, lung and osteoclasts and in several cell populations of hematopoietic origin. It is in these cells (particularly T lymphocytes) that KV1.3 function has centered a lot of attention. It was found that KV1.3 is the main channel   Responsible for maintaining the resting potential in quiescent cells and regulating the Ca2+ signaling that is indispensable for normal T lymphocyte activation.1,2   Based on the central role of Kv1.3 in regulating the initiation of an immune response, the channel has been recognized as a potential target for immunosuppressant drugs.1  KV1.3 channels are potently inhibited by several venomous peptide toxins among them Charybdotoxin (#STC-325, 2.6 nM), Noxiustoxin (#STN-340, 1 nM), Kaliotoxin (#STK-370, 0.65 nM), Margatoxin (#STM-325, 0.05 nM), Agitoxin-1 (#RTA-150, 1.7 nM), Agitoxin-2 (#RTA-420, 0.004 nM), Hongotoxin-1 (#RTH-400, 0.09 nM)  and Stichodactyla toxin (#RTS-400, 0.01 nM).3-7


References 1. Chandy, K.G. et al. (2001) Toxicon 39, 1269. 2. Koo, G.C. et al. (1997) J. Immunol. 158, 5120. 3. Grissmer, S. et al. (1994) Mol. Pharmacol. 45, 1227. 4. Garcia-Calvo, M. et al. (1993) J. Biol. Chem. 268, 18866. 5. Garcia, M.L. et al. (1994) Biochemistry 33, 6834. 6. Koschak, A. et al. (1998) J. Biol. Chem. 273, 2639. 7. Kalman, K. et al. (1998) J. Biol. Chem. 273, 32697.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 247.00
$ 367.00
$ 475.00
Cat# AG1154-025
Availability: 2-3 weeks
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Crown Flash21-30% Off
Terms & Conditions