Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Kir1.1 Antibody   

Kir1.1 Antibody

Affinity purified polyclonal antibody

  • WB - Kir1.1 Antibody AG1155-025
    Western blot analysis of rat kidney membranes:
    1. Anti-Kir1.1 (ROMK1) antibody (#AG1155), (1:200).
    2. Anti-Kir1.1 (ROMK1) antibody, preincubated with the control antigen.
  • IHC - Kir1.1 Antibody AG1155-025
    Expression of Kir1.1 in rat kidney Immunohistochemical staining of rat kidney sections using Anti-Kir1.1 (ROMK1) antibody (#AG1155), (left). There is stong staining (red) of tubular epithelial cells in distal tubes. Note that no staining is observed in proximal tubules (arrow). Counterstain of cell nuclei appears blue. A negative control is shown (right).
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P35560
Reactivity Mouse, Rat
Host Rabbit
Clonality Polyclonal
Calculated MW 44963 Da
Homology Mouse - identical; human - 45/50 amino acid residues identical.
Additional Information
Gene ID 24521
Other Names ATP-sensitive inward rectifier potassium channel 1, ATP-regulated potassium channel ROM-K, Inward rectifier K(+) channel Kir11, KAB-1, Potassium channel, inwardly rectifying subfamily J member 1, Kcnj1, Romk1
Related products for control experimentsControl peptide antigen (supplied with the antibody free of charge).
Target/Specificity GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat ROMK1 (Accession P35560), (MW: 33 kDa).ֲ Intracellular, C-terminus.
Dilution WB~~1:200-1:2000
Format Affinity purified antibody, lyophilized powder
Reconstitution 50 µl or 0.2 ml deionized water, depending on the sample size.
Antibody Concentration After Reconstitution 0.8 mg/ml.
Buffer After Reconstitution Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.025% NaN3.
Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage After ReconstitutionThe reconstituted solution can be stored at 4ºC for up to 2 weeks. For longer periods, small aliquots should be stored at -20ºC or below. Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).
Control Antigen Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control Antigen Reconstitution 100 µl PBS.
Control Antigen Storage After Reconstitution-20ºC.
Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Kir1.1 (ROMK1) was the first member of the family of inward rectifying K+ channels to be cloned.1 The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels.   The family’s topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N- and C-termini. As is the case for the voltage-dependent K+ channels the functional unit for the Kir channels is composed of four subunits that can assembly as either homo or heterotetramers.   Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus making them essential for controlling resting membrane potential and K+ homeostasis.3 As its original name indicates (ROMK1 stands for Renal Outer Medullary K+ channel) Kir1.1 is strongly expressed in the kidney in the apical membrane of several kidney segments such as the thick ascending loop of Henle (TAL) and the cortical collecting duct (CCD). In addition, the channel is also expressed in the brain mainly in the cortex and hippocampus.3   Kir1.1 plays a key role in K+ recycling in the loop of Henle. Indeed, loss of function mutations in the Kir1.1 gene cause Bartter’s syndrome type II, a recessive autosomal disease characterized by the impairment of K+ efflux and the subsequent inability of the NKCC2 transporter to continue NaCl uptake. This leads to a high salt concentration in the urine that induces osmotic diuresis and low plasma volume.2   Pharmacologically, the Kir1.1 channel can be inhibited by several general K+ channel blockers such as Tertiapin (#STT-250), however the scorpion toxin Lq2 (#RTL-550) specifically and potently inhibits Kir1.1 channels.4 


References 1. Ho, K. et al. (1993) Nature 362, 31. 2. Simon, D.B. et al. (1996) Nat. Genet. 14, 152. 3.  Wang, W-H. (2006) Am. J. Physiol. Renal Physiol. 290, F14. 4. Lu, Z. and McKinnon, R. (1997) Biochemistry 36, 6936.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 247.00
$ 367.00
$ 475.00
Cat# AG1155-025
Availability: 2-3 weeks
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Other Products

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
30% off on 2,800+ Neuroscience Antibodies. PromoCode:<span class=text-red> FLASH20
Terms & Conditions