Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   GPCR Antibodies   >   M2 Muscarinic Receptor Antibody   

M2 Muscarinic Receptor Antibody

Affinity purified rabbit polyclonal antibody

  • WB - M2 Muscarinic Receptor  Antibody AG1218-025
    Western blot analysis of rat brain membranes: 1. Anti-M2 Muscarinic Receptor antibody (#AG1218), (1:200). 2. Anti-M2 Muscarinic Receptor antibody, preincubated with the control fusion protein antigen.
  • IHC - M2 Muscarinic Receptor  Antibody AG1218-025
    Expression of M2 Muscarinic Receptor in mouse parieto-temporal cortex sections Immunohistochemical staining of mouse parieto-temporal cortex frozen sections (non-consecutive) using Anti-Kir3.2 (GIRK2) antibody (#APC-006), (1:100) and Anti-M2 Muscarinic Receptor antibody (#AG1218), (1:100). M2 Muscarinic Receptor staining (red) was dense in layer IV, with fibers climbing to layers II-III. Kir3.2 K+ channel staining (green) was dense in layers IV and I. Overlapping expression of Kir3.2 channel and M2 muscarinic Receptor is seen in cortical layers.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P08172
Reactivity Human, Mouse, Rat
Host Rabbit
Clonality Polyclonal
Calculated MW 51715 Da
Homology Chimpanzee, gorilla - identical; orangutan - 130/132 amino acid residues identical; pig - 122/132 amino acid residues identical; rat - 118/132 amino acid residues identical; mouse - 117/132 amino acid residues identical; dog - 122/132 amino acid residues identical.
Additional Information
Gene ID 1129
Other Names Muscarinic acetylcholine receptor M2, CHRM2
Related products for control experimentsControl peptide antigen (supplied with the antibody free of charge).
Target/Specificity GST fusion protein with a sequence VANQDPVSPSLVQGRIVKPN NNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSV SAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS DSCTPTNTTVEVVGSSGQNGDE, corresponding to amino acid residues 225-356 of human m2 (Accession P08172). 3rd intracellular loop.
Dilution WB~~1:200-1:2000
Peptide Confirmation Confirmed by DNA sequence and SDS-PAGE.
Format Affinity purified antibody, lyophilized powder
Reconstitution 50 µl or 0.2 ml deionized water, depending on the sample size.
Antibody Concentration After Reconstitution 0.8 mg/ml.
Buffer After Reconstitution Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage After ReconstitutionThe reconstituted solution can be stored at 4ºC for up to 2 weeks. For longer periods, small aliquots should be stored at -20ºC or below. Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).
Control Antigen Storage Before ReconstitutionLyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control Antigen Reconstitution 100 µl PBS.
Control Antigen Storage After Reconstitution-20ºC.
Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


The action of the neurotransmitter acetylcholine is mediated through two types of receptors, the ionotrophic nicotinic receptors and the metabotrophic muscarinic receptors. The muscarinic receptors belong to the superfamily of 7-TM G-protein-coupled receptors. Five subtypes of muscarinic receptors have been cloned and are named m1-m5.1-2 The muscarinic receptors are widely distributed throughout the body, but are predominantly expressed within the parasympathetic nervous system and exerts both excitatory and inhibitory control over central and peripheral tissues.1-2 Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing and motor control.1 They also participate in learning and memory processing.3-4 The m2 receptor is considered to be the predominant muscarinic receptor that is expressed in cardiac muscle.5 The m2 and m4 receptors mediate Ca2+ channel inhibition and Kir3 K+ channel activation by directly binding the Gbg subunit to the channel.6,7 Stimulation of the m2 receptor by acetylcholine in the heart results in activation of the Kir3.1/Kir3.4 channels causing a slowing in heart beat.7 Abgent is pleased to offer a highly specific antibody directed against the 3rd intracellular loop of the human m2 receptor. Anti-M2 Muscarinic Receptor antibody (#AG1218) can be used in western blot analysis, immunoprecipitation, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize m1 from mouse and rat and human samples.


1. Felder, C.C. et al. (2000) J. Med. Chem. 43, 4333.
2. Forsythe, S.M. et al. (2002) Am. J. Respir. Cell. Mol. Biol. 26, 298.
3. Ferreira, A.R. et al. (2003) Pharmacol. Biochem. Behav. 74, 411.
4. Van der Zee, E.A. and Luiten, P.G. (1999) Prog. Neurol. 58, 409.
5. Tata, A.M. et al. (1999) Brain Res. 824, 63.
6. Shapiro, M.S. et al. (1999) Proc. Natl. Acad. Sci. U.S.A. 96, 10899.
7. Jin, W. and Lu, Z. (1998) Biochemistry 37, 13291.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 247.00
$ 367.00
$ 475.00
Cat# AG1218-025
Availability: 2-3 weeks
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Crown Flash21-30% Off
Terms & Conditions