Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >    DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Antibody - With BSA and Azide   

DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Antibody - With BSA and Azide

Purified Mouse Monoclonal Antibody

  •  -  DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Antibody - With BSA and Azide AH10156-20
    Formalin-fixed, paraffin-embedded human gastrointestinal stromal tumor (20X) stained with DOG1 MAb (DOG1.1).
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q5XXA6
Reactivity Human
Host Mouse
Clonality Monoclonal
Isotype IgG1, kappa
Clone Names DOG-1.1
Calculated MW ~114kDa
Additional Information
Gene ID 55107
Other Names Anoctamin-1, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, Transmembrane protein 16A, Tumor-amplified and overexpressed sequence 2, ANO1, DOG1, ORAOV2, TAOS2, TMEM16A
Target/Specificity A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Application Note ELISA : For coating, order Ab without BSA
Flow Cytometry : 0.5-1ug/million cells
Immunofluorescence : 0.5-1.0 µg/ml
Western Blotting : 0.5-1.0 µg/ml
Immunoprecipitation : 0.5-1 µg/500ug protein lysate
Immunohistology (Frozen & Formalin-fixed) : 0.5-1.0 µg/ml for 30 minutes at RT
(Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes).
Format 0.5 ml at 200ug/ml with BSA and azide
StorageStore at 2 to 8°C.Antibody is stable for 24 months.
Precautions DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Antibody - With BSA and Azide is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name ANO1
Synonyms DOG1, ORAOV2, TAOS2, TMEM16A
Function Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development.
Cellular Location Cell membrane; Multi- pass membrane protein. Cytoplasm. Note=Cytoplasmic localization seen in neoplastic cells of head and neck squamous cell carcinoma (HNSCC) tumors.
Tissue Location Broadly expressed with higher levels in liver, skeletal muscle and gastrointestinal muscles
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST’s), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST’s, including all c-kit negative GIST’s. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST’s is nearly identical: 94.4% vs. 94.7%.


1. Espinosa I, et. al. Am J Surg Pathol 2008;32:210–218.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 124.00
$ 324.00
$ 454.00
Cat# AH10156-20
Availability: 2-3 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
30% off on 400+ Stem Cells Antibodies. PromoCode: <span class=text-red>FLASH19</span>
Terms & Conditions