Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Cell Biology   >   C1orf49 Antibody - C-terminal region   

C1orf49 Antibody - C-terminal region

Rabbit Polyclonal Antibody

  • WB - C1orf49 Antibody - C-terminal region AI15477

    WB Suggested Anti-C1orf49 Antibody Titration: 1.0 μg/ml
    Positive Control: Jurkat Whole Cell
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q5T0J7
Other Accession NM_032126, NP_115502
Reactivity Human
Predicted Human
Host Rabbit
Clonality Polyclonal
Calculated MW 26kDa
Additional Information
Alias Symbol DKFZp564J047, FLJ40199, MGC26863, RP5-990P15.1, C1orf49
Other Names Testis-expressed sequence 35 protein, Tex35, C1orf49
Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution & Storage Add 50 ul of distilled water. Final anti-C1orf49 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at 20°C. Avoid repeat freeze-thaw cycles.
PrecautionsC1orf49 Antibody - C-terminal region is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name Tex35
Synonyms C1orf49
Tissue Location Testis-specific. EMBL; AL136694; CAB66629.1; -; mRNA EMBL; AK093269; BAC04115.1; -; mRNA EMBL; AK097518; BAC05085.1; -; mRNA EMBL; AL513013; CAI23535.1; -; Genomic_DNA EMBL; AL513013; CAI23536.1; -; Genomic_DNA EMBL; AL513013; CAI23537.1; -; Genomic_DNA EMBL; AL513013; CAI23538.1; -; Genomic_DNA EMBL; BC034972; AAH34972.1; -; mRNA CCDS; CCDS1323.1; -. [Q5T0J7-1] CCDS; CCDS53433.1; -. [Q5T0J7-5] CCDS; CCDS53434.1; -. [Q5T0J7-2] RefSeq; NP_001164193.1; NM_001170722.1. [Q5T0J7-2] RefSeq; NP_001164194.1; NM_001170723.1. [Q5T0J7-5] RefSeq; NP_001164195.1; NM_001170724.1 RefSeq; NP_115502.2; NM_032126.4. [Q5T0J7-1] UniGene; Hs.534501; - ProteinModelPortal; Q5T0J7; - BioGrid; 123861; 28 IntAct; Q5T0J7; 4 MINT; MINT-4725644; - STRING; 9606.ENSP00000323795; - iPTMnet; Q5T0J7; - PhosphoSitePlus; Q5T0J7; - BioMuta; Tex35; - DMDM; 74744310; - PaxDb; Q5T0J7; - PeptideAtlas; Q5T0J7; - PRIDE; Q5T0J7; - DNASU; 84066; - Ensembl; ENST00000319416; ENSP00000323795; ENSG00000240021. [Q5T0J7-1] Ensembl; ENST00000367639; ENSP00000356611; ENSG00000240021. [Q5T0J7-2] Ensembl; ENST00000367641; ENSP00000356613; ENSG00000240021. [Q5T0J7-3] Ensembl; ENST00000367643; ENSP00000356615; ENSG00000240021. [Q5T0J7-5] GeneID; 84066; - KEGG; hsa:84066; - UCSC; uc001glt.3; human. [Q5T0J7-1] CTD; 84066; - DisGeNET; 84066; - GeneCards; TEX35; - HGNC; HGNC:25366; TEX35 HPA; HPA039190; - HPA; HPA041719; - neXtProt; NX_Q5T0J7; - OpenTargets; ENSG00000240021; - PharmGKB; PA134904440; - eggNOG; ENOG410IZ1Y; Eukaryota eggNOG; ENOG411197W; LUCA GeneTree; ENSGT00390000011962; - HOGENOM; HOG000111219; - HOVERGEN; HBG058182; - InParanoid; Q5T0J7; - OMA; QIKDVMD; - OrthoDB; EOG091G0VGU; - PhylomeDB; Q5T0J7; - TreeFam; TF337831; - BioCyc; ZFISH:G66-31416-MONOMER; - GeneWiki; C1orf49; - GenomeRNAi; 84066; - PRO; PR:Q5T0J7; - Proteomes; UP000005640; Chromosome 1 Bgee; ENSG00000240021; - CleanEx; HS_C1orf49; - ExpressionAtlas; Q5T0J7; baseline and differential Genevisible; Q5T0J7; HS GO; GO:0015630; C:microtubule cytoskeleton; IDA:LIFEdb GO; GO:0005634; C:nucleus; ISS:UniProtKB InterPro; IPR027874; Tex35 Pfam; PF15079; Tsc35; 1 2: Evidence at transcript level; Alternative splicing; Coiled coil; Complete proteome; Polymorphism; Reference proteome CHAIN 1 233 Testis-expressed sequence 35 protein /FTId=PRO_0000251187 COILED 45 111 VAR_SEQ 1 76 Missing (in isoform 4) /FTId=VSP_020737 VAR_SEQ 13 13 L -> LVKERHCWT (in isoform 2) /FTId=VSP_020738 VAR_SEQ 182 233 EKCLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHA VPAPKSQTEGR -> VSETLPEPSTGARPLAPAPW (in isoform 3) /FTId=VSP_020739 VAR_SEQ 196 233 GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR -> GIYAAVGLLDLW (in isoform 2) /FTId=VSP_020740 VAR_SEQ 196 233 GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR -> AAPLKEARHLLTANSIDPSAALVLLIEFLLLTLVTGAAAPG LDACGHQRNMRDEINSERR (in isoform 4) /FTId=VSP_020741 VAR_SEQ 196 233 GNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR -> AQLQNLPAVPIHHLQAP (in isoform 5) /FTId=VSP_045739 VARIANT 55 55 E -> G (in dbSNP:rs16852957) /FTId=VAR_027656 VARIANT 146 146 A -> G (in dbSNP:rs12079481) /FTId=VAR_027657 VARIANT 171 171 L -> P (in dbSNP:rs3813636) /FTId=VAR_059592 VARIANT 171 171 L -> R (in dbSNP:rs3813636) /FTId=VAR_027658 CONFLICT 14 14 S -> C (in Ref. 1; CAB66629) SEQUENCE 233 AA; 26518 MW; 0B8B9168E1809B05 CRC64; MSAKRAELKK THLSKNYKAV CLELKPEPTK TFDYKAVKQE GRFTKAGVTQ DLKNELREVR EELKEKMEEI KQIKDLMDKD FDKLHEFVEI MKEMQKDMDE KMDILINTQK NYKLPLRRAP KEQQELRLMG KTHREPQLRP KKMDGASGVN GAPCALHKKT MAPQKTKQGS LDPLHHCGTC CEKCLLCALK NNYNRGNIPS EASGLYKGGE EPVTTQPSVG HAVPAPKSQT EGR
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Wiemann S.,et al.Genome Res. 11:422-435(2001).
Ota T.,et al.Nat. Genet. 36:40-45(2004).
Gregory S.G.,et al.Nature 441:315-321(2006).
Tang A.,et al.Biol. Pharm. Bull. 29:2187-2191(2006).

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 293.00
Cat# AI15477
Availability: 2-3 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Crown Flash21-30% Off
Terms & Conditions