Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Cell Biology   >   TMEM174 Antibody - C-terminal region   

TMEM174 Antibody - C-terminal region

Rabbit Polyclonal Antibody

     
  • WB - TMEM174 Antibody - C-terminal region AI15730

    Host: Rabbit
    Target Name: TMEM174
    Sample Tissue: Jurkat Whole cell lysate
    s
    Antibody Dilution: 1.0μg/ml
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession Q8WUU8
Other Accession NM_153217, NP_694949
Reactivity Human
Predicted Human
Host Rabbit
Clonality Polyclonal
Calculated MW 26kDa
Additional Information
Other Names Transmembrane protein 174, TMEM174
Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution & Storage Add 50 ul of distilled water. Final anti-TMEM174 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at 20°C. Avoid repeat freeze-thaw cycles.
PrecautionsTMEM174 Antibody - C-terminal region is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name TMEM174
Cellular Location Endoplasmic reticulum membrane; Multi-pass membrane protein
Tissue Location Predominantly expressed in kidney. EMBL; AK055830; BAB71025.1; -; mRNA EMBL; AK315460; BAG37847.1; -; mRNA EMBL; CH471084; EAW95719.1; -; Genomic_DNA EMBL; BC019346; AAH19346.1; -; mRNA CCDS; CCDS4018.1; -. [Q8WUU8-1] RefSeq; NP_694949.1; NM_153217.2. [Q8WUU8-1] UniGene; Hs.508588; - ProteinModelPortal; Q8WUU8; - BioGrid; 126393; 2 IntAct; Q8WUU8; 3 PhosphoSitePlus; Q8WUU8; - BioMuta; TMEM174; - DMDM; 74730764; - PaxDb; Q8WUU8; - PRIDE; Q8WUU8; - DNASU; 134288; - Ensembl; ENST00000296776; ENSP00000296776; ENSG00000164325. [Q8WUU8-1] GeneID; 134288; - KEGG; hsa:134288; - UCSC; uc010izc.4; human. [Q8WUU8-1] CTD; 134288; - DisGeNET; 134288; - GeneCards; TMEM174; - HGNC; HGNC:28187; TMEM174 HPA; HPA037975; - MIM; 614909; gene neXtProt; NX_Q8WUU8; - OpenTargets; ENSG00000164325; - PharmGKB; PA162405935; - eggNOG; ENOG410IR9J; Eukaryota eggNOG; ENOG410YMC9; LUCA GeneTree; ENSGT00390000004161; - HOGENOM; HOG000059655; - HOVERGEN; HBG095684; - InParanoid; Q8WUU8; - OMA; PPQYYTI; - OrthoDB; EOG091G0I7E; - PhylomeDB; Q8WUU8; - TreeFam; TF335512; - BioCyc; ZFISH:ENSG00000164325-MONOMER; - GenomeRNAi; 134288; - PRO; PR:Q8WUU8; - Proteomes; UP000005640; Chromosome 5 Bgee; ENSG00000164325; - CleanEx; HS_TMEM174; - ExpressionAtlas; Q8WUU8; baseline and differential Genevisible; Q8WUU8; HS GO; GO:0005789; C:endoplasmic reticulum membrane; IEA:UniProtKB-SubCell GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW InterPro; IPR027835; TMEM174 PANTHER; PTHR31020; PTHR31020; 1 Pfam; PF15029; TMEM174; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Endoplasmic reticulum; Membrane; Reference proteome; Transmembrane; Transmembrane helix CHAIN 1 243 Transmembrane protein 174 /FTId=PRO_0000282577 TRANSMEM 40 60 Helical. TRANSMEM 73 93 Helical. VAR_SEQ 210 243 PNPDVDQLEETQLEEEACACFSPPPYEEIYSLPR -> YGP ILMLTS (in isoform 2) /FTId=VSP_024210 SEQUENCE 243 AA; 26287 MW; 05A764F265B50258 CRC64; MEQGSGRLED FPVNVFSVTP YTPSTADIQV SDDDKAGATL LFSGIFLGLV GITFTVMGWI KYQGVSHFEW TQLLGPVLLS VGVTFILIAV CKFKMLSCQL CKESEERVPD SEQTPGGPSF VFTGINQPIT FHGATVVQYI PPPYGSPEPM GINTSYLQSV VSPCGLITSG GAAAAMSSPP QYYTIYPQDN SAFVVDEGCL SFTDGGNHRP NPDVDQLEET QLEEEACACF SPPPYEEIYS LPR
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

References

Ota T.,et al.Nat. Genet. 36:40-45(2004).
Mural R.J.,et al.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
Wang P.,et al.Biochem. Biophys. Res. Commun. 394:993-999(2010).

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 293.00
Cat# AI15730
Size:
Quantity:
Availability: 2-3 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Crown-Flash18
Terms & Conditions