Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   LIMS1 Antibody   

LIMS1 Antibody

Rabbit Monoclonal Antibody

     
  • WB - LIMS1 Antibody AJ1445a
    A. Western blot analysis on (A) Jurkat (B) K562 C) HeLa and (D) 293 cell lysates using anti-LIMS1 RabMAb (Cat. #AJ1445a), dilution 1:5000.
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB
Primary Accession P48059
Reactivity Human, Mouse, Rat
Host Rabbit
Clonality Monoclonal
Clone Names EP1943Y
Other Names LIM and senescent cell antigen-like-containing domain protein 1, Particularly interesting new Cys-His protein 1, PINCH-1, Renal carcinoma antigen NY-REN-48, LIMS1, PINCH, PINCH1
Target/Specificity A synthetic peptide corresponding to residues within LIM zinc-binding 3 region of human LIMS1 was used as an immunogen.
Dilution WB~~1:1000~5000
Format 50 mM Tris-Glycine (pH 7.4), 0.15 M NaCl, 40% Glycerol, 0.01% sodium azide and 0.05% BSA.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsLIMS1 Antibody is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name LIMS1
Synonyms PINCH, PINCH1
Function Adapter protein in a cytoplasmic complex linking beta- integrins to the actin cytoskeleton, bridges the complex to cell surface receptor tyrosine kinases and growth factor receptors. Involved in the regulation of cell survival, cell proliferation and cell differentiation.
Cellular Location Cell junction, focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side
Tissue Location Expressed in most tissues except in the brain. EMBL; U09284; AAA20086.2; -; mRNA EMBL; AK296992; BAH12469.1; -; mRNA EMBL; AK302411; BAH13699.1; -; mRNA EMBL; AK304260; BAH14143.1; -; mRNA EMBL; AK314217; BAG36891.1; -; mRNA EMBL; AC010095; AAY14983.1; -; Genomic_DNA EMBL; AC012487; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC005341; AAH05341.1; -; mRNA CCDS; CCDS2078.1; -. [P48059-1] CCDS; CCDS54382.1; -. [P48059-2] CCDS; CCDS54383.1; -. [P48059-4] CCDS; CCDS54384.1; -. [P48059-5] CCDS; CCDS54385.1; -. [P48059-3] PIR; JC2324; JC2324 RefSeq; NP_001180411.1; NM_001193482.1. [P48059-4] RefSeq; NP_001180412.1; NM_001193483.2. [P48059-2] RefSeq; NP_001180413.1; NM_001193484.1. [P48059-5] RefSeq; NP_001180414.1; NM_001193485.2. [P48059-3] RefSeq; NP_001180417.1; NM_001193488.1. [P48059-1] RefSeq; NP_004978.2; NM_004987.5. [P48059-1] UniGene; Hs.597715; - UniGene; Hs.613268; - PDB; 1G47; NMR; -; A=1-70 PDB; 1NYP; NMR; -; A=188-251 PDB; 1U5S; NMR; -; B=188-251 PDB; 2COR; NMR; -; A=125-190 PDB; 2D8X; NMR; -; A=71-127 PDB; 2KBX; NMR; -; B=1-70 PDB; 3F6Q; X-ray; 1.60 A; B=6-68 PDB; 4HI8; X-ray; 1.20 A; B=6-68 PDB; 4HI9; X-ray; 1.20 A; B=6-68 PDBsum; 1G47; - PDBsum; 1NYP; - PDBsum; 1U5S; - PDBsum; 2COR; - PDBsum; 2D8X; - PDBsum; 2KBX; - PDBsum; 3F6Q; - PDBsum; 4HI8; - PDBsum; 4HI9; - ProteinModelPortal; P48059; - SMR; P48059; - BioGrid; 110175; 37 DIP; DIP-40671N; - IntAct; P48059; 52 MINT; P48059; - STRING; 9606.ENSP00000446121; - iPTMnet; P48059; - PhosphoSitePlus; P48059; - BioMuta; LIMS1; - DMDM; 18266876; - OGP; P48059; - EPD; P48059; - MaxQB; P48059; - PaxDb; P48059; - PeptideAtlas; P48059; - PRIDE; P48059; - ProteomicsDB; 55846; - ProteomicsDB; 55847; -. [P48059-2] ProteomicsDB; 55848; -. [P48059-3] ProteomicsDB; 55849; -. [P48059-4] ProteomicsDB; 55850; -. [P48059-5] DNASU; 3987; - Ensembl; ENST00000332345; ENSP00000331775; ENSG00000169756. [P48059-1] Ensembl; ENST00000338045; ENSP00000337598; ENSG00000169756. [P48059-3] Ensembl; ENST00000393310; ENSP00000376987; ENSG00000169756. [P48059-1] Ensembl; ENST00000409441; ENSP00000387264; ENSG00000169756. [P48059-5] Ensembl; ENST00000410093; ENSP00000386926; ENSG00000169756. [P48059-4] Ensembl; ENST00000544547; ENSP00000437912; ENSG00000169756. [P48059-2] GeneID; 3987; - KEGG; hsa:3987; - UCSC; uc002teg.4; human. [P48059-1] CTD; 3987; - DisGeNET; 3987; - EuPathDB; HostDB:ENSG00000169756.16; - GeneCards; LIMS1; - HGNC; HGNC:6616; LIMS1 HPA; HPA058455; - HPA; HPA061230; - MIM; 602567; gene neXtProt; NX_P48059; - OpenTargets; ENSG00000169756; - PharmGKB; PA30389; - eggNOG; KOG2272; Eukaryota eggNOG; ENOG410XP46; LUCA GeneTree; ENSGT00760000118910; - HOGENOM; HOG000253950; - HOVERGEN; HBG000053; - InParanoid; P48059; - OMA; CRECNER; - OrthoDB; EOG091G08K3; - PhylomeDB; P48059; - TreeFam; TF314113; - Reactome; R-HSA-446353; Cell-extracellular matrix interactions Reactome; R-HSA-446388; Regulation of cytoskeletal remodeling and cell spreading by IPP complex components ChiTaRS; LIMS1; human EvolutionaryTrace; P48059; - GeneWiki; LIMS1; - GenomeRNAi; 3987; - PRO; PR:P48059; - Proteomes; UP000005640; Chromosome 2 Bgee; ENSG00000169756; - CleanEx; HS_LIMS1; - ExpressionAtlas; P48059; baseline and differential Genevisible; P48059; HS GO; GO:0005911; C:cell-cell junction; IMP:UniProtKB GO; GO:0005829; C:cytosol; TAS:Reactome GO; GO:0005925; C:focal adhesion; IDA:UniProtKB GO; GO:0048471; C:perinuclear region of cytoplasm; IDA:UniProtKB GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell GO; GO:0019901; F:protein kinase binding; IPI:UniProtKB GO; GO:0008270; F:zinc ion binding; IDA:UniProtKB GO; GO:0007569; P:cell aging; TAS:ProtInc GO; GO:0034329; P:cell junction assembly; TAS:Reactome GO; GO:0071560; P:cellular response to transforming growth factor beta stimulus; IEP:UniProtKB GO; GO:0045184; P:establishment of protein localization; IMP:UniProtKB GO; GO:0045892; P:negative regulation of transcription, DNA-templated; IDA:UniProtKB GO; GO:0010811; P:positive regulation of cell-substrate adhesion; IMP:UniProtKB GO; GO:0051894; P:positive regulation of focal adhesion assembly; IMP:UniProtKB GO; GO:0010628; P:positive regulation of gene expression; IMP:UniProtKB GO; GO:0043547; P:positive regulation of GTPase activity; IMP:UniProtKB GO; GO:1901224; P:positive regulation of NIK/NF-kappaB signaling; IMP:CAFA GO; GO:1900026; P:positive regulation of substrate adhesion-dependent cell spreading; IMP:UniProtKB GO; GO:0033209; P:tumor necrosis factor-mediated signaling pathway; IMP:CAFA InterPro; IPR017351; PINCH InterPro; IPR001781; Znf_LIM PANTHER; PTHR24210; PTHR24210; 1 Pfam; PF00412; LIM; 5 PIRSF; PIRSF038003; PINCH; 1 SMART; SM00132; LIM; 5 PROSITE; PS00478; LIM_DOMAIN_1; 4 PROSITE; PS50023; LIM_DOMAIN_2; 5 1: Evidence at protein level; 3D-structure; Acetylation; Alternative splicing; Cell junction; Cell membrane; Complete proteome; Direct protein sequencing; LIM domain; Membrane; Metal-binding; Reference proteome; Repeat; Zinc INIT_MET 1 1 Removed. CHAIN 2 325 LIM and senescent cell antigen-like- containing domain protein 1 /FTId=PRO_0000075888 DOMAIN 10 62 LIM zinc-binding 1. {ECO:0000255|PROSITE- ProRule:PRU00125} DOMAIN 71 121 LIM zinc-binding 2. {ECO:0000255|PROSITE- ProRule:PRU00125} DOMAIN 135 184 LIM zinc-binding 3. {ECO:0000255|PROSITE- ProRule:PRU00125} DOMAIN 193 243 LIM zinc-binding 4. {ECO:0000255|PROSITE- ProRule:PRU00125} DOMAIN 252 303 LIM zinc-binding 5. {ECO:0000255|PROSITE- ProRule:PRU00125} MOD_RES 2 2 N-acetylalanine VAR_SEQ 1 1 M -> MLGVAAGMTHSNM (in isoform 2) /FTId=VSP_042672 VAR_SEQ 1 1 M -> MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDER AVSKLQRRHSDVKVYKEFCDFYAKFNM (in isoform 3). /FTId=VSP_043210 VAR_SEQ 1 1 M -> MTCNM (in isoform 4). /FTId=VSP_043211 VAR_SEQ 1 1 M -> MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELS NM (in isoform 5) /FTId=VSP_043212 MUTAGEN 42 42 F->A: Loss of interaction with ILK and loss of localization to focal adhesion MUTAGEN 56 56 R->A: Alters interaction with ILK MUTAGEN 61 61 H->D: Alters interaction with ILK MUTAGEN 62 62 D->A: Alters interaction with ILK MUTAGEN 66 66 L->D: Alters interaction with ILK CONFLICT 78 78 I -> T (in Ref. 5; AAH05341) CONFLICT 262 262 D -> G (in Ref. 5; AAH05341) TURN 11 13 {ECO:0000244|PDB:4HI8} STRAND 22 26 {ECO:0000244|PDB:4HI8} STRAND 29 32 {ECO:0000244|PDB:4HI8} TURN 33 35 {ECO:0000244|PDB:4HI8} TURN 39 41 {ECO:0000244|PDB:4HI8} HELIX 46 48 {ECO:0000244|PDB:4HI8} STRAND 51 53 {ECO:0000244|PDB:4HI8} STRAND 56 58 {ECO:0000244|PDB:4HI8} HELIX 60 66 {ECO:0000244|PDB:4HI8} STRAND 72 74 {ECO:0000244|PDB:2D8X} STRAND 83 85 {ECO:0000244|PDB:2D8X} STRAND 88 90 {ECO:0000244|PDB:2D8X} TURN 92 94 {ECO:0000244|PDB:2D8X} STRAND 98 100 {ECO:0000244|PDB:2D8X} STRAND 105 107 {ECO:0000244|PDB:2D8X} STRAND 110 112 {ECO:0000244|PDB:2D8X} STRAND 115 117 {ECO:0000244|PDB:2D8X} HELIX 119 126 {ECO:0000244|PDB:2D8X} TURN 136 138 {ECO:0000244|PDB:2COR} STRAND 150 152 {ECO:0000244|PDB:2COR} TURN 156 158 {ECO:0000244|PDB:2COR} STRAND 162 164 {ECO:0000244|PDB:2COR} STRAND 173 175 {ECO:0000244|PDB:2COR} STRAND 178 180 {ECO:0000244|PDB:2COR} HELIX 182 186 {ECO:0000244|PDB:2COR} TURN 194 197 {ECO:0000244|PDB:1NYP} STRAND 210 213 {ECO:0000244|PDB:1NYP} TURN 214 216 {ECO:0000244|PDB:1NYP} TURN 220 222 {ECO:0000244|PDB:1NYP} STRAND 227 229 {ECO:0000244|PDB:1NYP} STRAND 232 234 {ECO:0000244|PDB:1NYP} STRAND 237 239 {ECO:0000244|PDB:1NYP} HELIX 241 247 {ECO:0000244|PDB:1NYP} SEQUENCE 325 AA; 37251 MW; E665FEB11D849CAE CRC64; MANALASATC ERCKGGFAPA EKIVNSNGEL YHEQCFVCAQ CFQQFPEGLF YEFEGRKYCE HDFQMLFAPC CHQCGEFIIG RVIKAMNNSW HPECFRCDLC QEVLADIGFV KNAGRHLCRP CHNREKARGL GKYICQKCHA IIDEQPLIFK NDPYHPDHFN CANCGKELTA DARELKGELY CLPCHDKMGV PICGACRRPI EGRVVNAMGK QWHVEHFVCA KCEKPFLGHR HYERKGLAYC ETHYNQLFGD VCFHCNRVIE GDVVSALNKA WCVNCFACST CNTKLTLKNK FVEFDMKPVC KKCYEKFPLE LKKRLKKLAE TLGRK
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

LIM and senescent cell antigen-like domains 1 (LIMS1, PINCH1) is an adaptor protein which contains five LIM domains. LIM are two zinc finger motifs with links to regulatory function (1). LIMS1 is thought to be involved in integrin and growth factor signaling. During integrin signaling, LIMS1 interacts with ILK, through its LIM domain. LIMS1 also acts as a bridge linking ILK to NCK2, assisting in growth factor signaling pathways. LIMS1 has been linked to coupling surface receptors to downstream signaling molecules involved in the regulation of cell differentiation, cell proliferation, and cell survival (2).

References

1. Tu Y, et al, Mol. Biol. Cell 9:3367-3382, 1998.
2. Rearden A, et al. Biochem Biophys Res Commun 201(3):1124-31. 1994.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

Discontinued
Cat# AJ1445a
Size:
Alternative Products:

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Other Products

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions