Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   DAOA Antibody   

DAOA Antibody

Rabbit Polyclonal Antibody

  • IHC - DAOA Antibody ALS16482
    Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession P59103
Reactivity Human
Host Rabbit
Clonality Polyclonal
Calculated MW 18kDa
Dilution IHC-P (10 µg/ml)
Additional Information
Other Names D-amino acid oxidase activator, Protein G72, DAOA, G72
Target/Specificity Human DAOA
Reconstitution & Storage Long term: -20°C; Short term: +4°C. Avoid repeat freeze-thaw cycles.
PrecautionsDAOA Antibody is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Synonyms G72
Function Seems to activate D-amino acid oxidase.
Cellular Location Golgi apparatus.
Tissue Location Expressed in amygdala, caudate nucleus, spinal cord and testis EMBL; AE014294; AAN16027.1; -; Genomic_DNA EMBL; AE014294; AAN16028.1; -; Genomic_DNA EMBL; AY138546; AAN08432.1; -; mRNA EMBL; AY138547; AAN08433.1; -; mRNA EMBL; AY170469; AAO12727.1; -; mRNA EMBL; AY223901; AAO73604.1; -; mRNA EMBL; DQ343761; ABC59904.1; -; mRNA EMBL; DQ357223; ABC86111.1; -; mRNA EMBL; AL359751; CAH70815.1; -; Genomic_DNA EMBL; CH471085; EAX09080.1; -; Genomic_DNA EMBL; BC121091; AAI21092.1; -; mRNA CCDS; CCDS41905.1; -. [P59103-1] CCDS; CCDS53880.1; -. [P59103-3] RefSeq; NP_001155284.1; NM_001161812.1 RefSeq; NP_001155286.1; NM_001161814.1. [P59103-3] RefSeq; NP_758958.3; NM_172370.4. [P59103-1] RefSeq; XP_005254099.1; XM_005254042.1. [P59103-4] UniGene; Hs.381382; - ProteinModelPortal; P59103; - SMR; P59103; - IntAct; P59103; 1 MINT; MINT-8204618; - STRING; 9606.ENSP00000365103; - BioMuta; DAOA; - DMDM; 84028201; - PaxDb; P59103; - PRIDE; P59103; - Ensembl; ENST00000329625; ENSP00000329951; ENSG00000182346. [P59103-3] Ensembl; ENST00000375936; ENSP00000365103; ENSG00000182346. [P59103-1] Ensembl; ENST00000473269; ENSP00000470244; ENSG00000182346. [P59103-4] Ensembl; ENST00000559369; ENSP00000453831; ENSG00000182346. [P59103-3] Ensembl; ENST00000600388; ENSP00000472260; ENSG00000182346. [P59103-3] Ensembl; ENST00000618629; ENSP00000483757; ENSG00000182346. [P59103-1] GeneID; 267012; - KEGG; hsa:267012; - UCSC; uc001vqb.5; human. [P59103-1] CTD; 267012; - DisGeNET; 267012; - GeneCards; DAOA; - HGNC; HGNC:21191; DAOA HPA; HPA053114; - MalaCards; DAOA; - MIM; 607408; gene neXtProt; NX_P59103; - OpenTargets; ENSG00000182346; - PharmGKB; PA134924986; - eggNOG; ENOG410KIB9; Eukaryota eggNOG; ENOG4110QEM; LUCA GeneTree; ENSGT00410000028557; - HOGENOM; HOG000112142; - InParanoid; P59103; - OMA; ARNYEAS; - OrthoDB; EOG091G0PUQ; - PhylomeDB; P59103; - TreeFam; TF354179; - BioCyc; ZFISH:G66-30786-MONOMER; - GenomeRNAi; 267012; - PRO; PR:P59103; - Proteomes; UP000005640; Chromosome 13 CleanEx; HS_DAOA; - ExpressionAtlas; P59103; baseline and differential Genevisible; P59103; HS GO; GO:0005794; C:Golgi apparatus; IDA:UniProtKB GO; GO:0005739; C:mitochondrion; IDA:UniProtKB GO; GO:0048471; C:perinuclear region of cytoplasm; IDA:UniProtKB GO; GO:0008047; F:enzyme activator activity; IDA:UniProtKB GO; GO:0019899; F:enzyme binding; IPI:UniProtKB GO; GO:1900758; P:negative regulation of D-amino-acid oxidase activity; IDA:UniProtKB GO; GO:0043085; P:positive regulation of catalytic activity; IDA:UniProtKB InterPro; IPR027929; DAOA Pfam; PF15199; DAOA; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Golgi apparatus; Polymorphism; Reference proteome CHAIN 1 153 D-amino acid oxidase activator /FTId=PRO_0000079781 VAR_SEQ 1 71 Missing (in isoform 3) {ECO:0000303|PubMed:12647258, ECO:0000303|Ref.3} /FTId=VSP_044292 VAR_SEQ 16 16 S -> V (in isoform 2). /FTId=VSP_004053 VAR_SEQ 17 153 Missing (in isoform 2). /FTId=VSP_004054 VAR_SEQ 95 153 LEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYN QQKDQSCNHKEITSTKAE -> HSKVILNGNLHCHFKRISQ IFAGHFMEGDTEA (in isoform 4) /FTId=VSP_044293 VARIANT 30 30 R -> K (in dbSNP:rs2391191) /FTId=VAR_014313 VARIANT 62 62 K -> E (in dbSNP:rs9558562) /FTId=VAR_050943 SEQUENCE 153 AA; 18108 MW; 597E2DE432A48EAE CRC64; MLEKLMGADS LQLFRSRYTL GKIYFIGFQR SILLSKSENS LNSIAKETEE GRETVTRKEG WKRRHEDGYL EMAQRHLQRS LCPWVSYLPQ PYAELEEVSS HVGKVFMARN YEFLAYEASK DRRQPLERMW TCNYNQQKDQ SCNHKEITST KAE
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Seems to activate D-amino acid oxidase.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 395.00
Cat# ALS16482
Availability: 5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Other Products

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions