Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Antibody Collections   >   GPCR Antibodies   >   Anti-COMMD4 Antibody   

Anti-COMMD4 Antibody

Rabbit Anti Human Polyclonal Antibody

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P, E
Primary Accession Q9H0A8
Predicted Human
Host Rabbit
Clonality Polyclonal
Isotype IgG
Dilution ELISA, IHC-P (20 µg/ml), WB
Additional Information
Alias Symbol COMMD4
Other Names COMMD4, COMM domain containing 4
Target/Specificity Human COMMD4
Reconstitution & Storage Caprylic acid and ammonium sulfate precipitation
PrecautionsAnti-COMMD4 Antibody is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name COMMD4
Function May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Down-regulates activation of NF-kappa-B.
Cellular Location Cytoplasm. Nucleus
Tissue Location Ubiquitous.. EMBL; AY542160; AAS22242.1; -; mRNA EMBL; AL136872; CAB66806.1; -; mRNA EMBL; CR533452; CAG38483.1; -; mRNA EMBL; AK000459; BAA91178.1; -; mRNA EMBL; AK314740; BAG37281.1; -; mRNA EMBL; AC068338; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471136; EAW99263.1; -; Genomic_DNA EMBL; BC000837; AAH00837.2; -; mRNA EMBL; BC068998; AAH68998.1; -; mRNA CCDS; CCDS10277.1; -. [Q9H0A8-1] CCDS; CCDS66834.1; -. [Q9H0A8-2] CCDS; CCDS66835.1; -. [Q9H0A8-3] RefSeq; NP_001271306.1; NM_001284377.1. [Q9H0A8-2] RefSeq; NP_001271307.1; NM_001284378.1. [Q9H0A8-3] RefSeq; NP_060298.2; NM_017828.4. [Q9H0A8-1] UniGene; Hs.351327; - ProteinModelPortal; Q9H0A8; - BioGrid; 120279; 49 CORUM; Q9H0A8; - IntAct; Q9H0A8; 18 STRING; 9606.ENSP00000267935; - iPTMnet; Q9H0A8; - PhosphoSitePlus; Q9H0A8; - DMDM; 51316094; - EPD; Q9H0A8; - MaxQB; Q9H0A8; - PaxDb; Q9H0A8; - PeptideAtlas; Q9H0A8; - PRIDE; Q9H0A8; - ProteomicsDB; 80236; - ProteomicsDB; 80237; -. [Q9H0A8-2] DNASU; 54939; - Ensembl; ENST00000267935; ENSP00000267935; ENSG00000140365. [Q9H0A8-1] Ensembl; ENST00000338995; ENSP00000340867; ENSG00000140365. [Q9H0A8-2] Ensembl; ENST00000480484; ENSP00000433662; ENSG00000140365. [Q9H0A8-1] Ensembl; ENST00000567195; ENSP00000457693; ENSG00000140365. [Q9H0A8-3] GeneID; 54939; - KEGG; hsa:54939; - UCSC; uc002azy.5; human. [Q9H0A8-1] CTD; 54939; - EuPathDB; HostDB:ENSG00000140365.15; - GeneCards; COMMD4; - HGNC; HGNC:26027; COMMD4 HPA; HPA066957; - MIM; 616701; gene neXtProt; NX_Q9H0A8; - OpenTargets; ENSG00000140365; - PharmGKB; PA134993083; - eggNOG; ENOG410IEAM; Eukaryota eggNOG; ENOG4111EZM; LUCA GeneTree; ENSGT00390000015516; - HOGENOM; HOG000006594; - HOVERGEN; HBG051069; - InParanoid; Q9H0A8; - KO; K22560; - PhylomeDB; Q9H0A8; - TreeFam; TF317482; - Reactome; R-HSA-8951664; Neddylation ChiTaRS; COMMD4; human GeneWiki; COMMD4; - GenomeRNAi; 54939; - PRO; PR:Q9H0A8; - Proteomes; UP000005640; Chromosome 15 Bgee; ENSG00000140365; - CleanEx; HS_COMMD4; - ExpressionAtlas; Q9H0A8; baseline and differential Genevisible; Q9H0A8; HS GO; GO:0005737; C:cytoplasm; IDA:LIFEdb GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell GO; GO:0006355; P:regulation of transcription, DNA-templated; IEA:UniProtKB-KW GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW CDD; cd04752; Commd4; 1 InterPro; IPR017920; COMM InterPro; IPR037356; Commd4 Pfam; PF07258; COMM_domain; 1 PROSITE; PS51269; COMM; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Cytoplasm; Nucleus; Reference proteome; Transcription; Transcription regulation; Ubl conjugation pathway CHAIN 1 199 COMM domain-containing protein 4 /FTId=PRO_0000077393 DOMAIN 130 199 COMM. {ECO:0000255|PROSITE- ProRule:PRU00602} VAR_SEQ 101 186 Missing (in isoform 3). /FTId=VSP_055664 VAR_SEQ 128 187 MNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTP AQPVAMSLSADKFQVLLAE -> K (in isoform 2) /FTId=VSP_011394 SEQUENCE 199 AA; 21764 MW; 7B7B85234E3FB59B CRC64; MRFRFCGDLD CPDWVLAEIS TLAKMSSVKL RLLCSQVLKE LLGQGIDYEK ILKLTADAKF ESGDVKATVA VLSFILSSAA KHSVDGESLS SELQQLGLPK EHAASLCRCY EEKQSPLQKH LRVCSLRMNR LAGVGWRVDY TLSSSLLQSV EEPMVHLRLE VAAAPGTPAQ PVAMSLSADK FQVLLAELKQ AQTLMSSLG
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.
FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 565.00
Cat# ALS17977
Size:
Quantity:
Availability: 5 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions