Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Stem Cells   >   CD168 Antibody   

CD168 Antibody

Purified Mouse Monoclonal Antibody

  • E - CD168 Antibody AO2068a

    Black line: Control Antigen (100 ng);
    Purple line: Antigen(10ng);
    Blue line: Antigen (50 ng);
    Red line: Antigen (100 ng);

  • WB - CD168 Antibody AO2068a

    Figure 2:Western blot analysis using CD168 mAb against human CD168 (AA: 306-497) recombinant protein. (Expected MW is 48.3 kDa)

  • WB - CD168 Antibody AO2068a

    Figure 3:Western blot analysis using CD168 mAb against HEK293 (1) and CD168 (AA: 306-497)-hIgGFc transfected HEK293 (2) cell lysate.

  • FC - CD168 Antibody AO2068a

    Figure 4:Flow cytometric analysis of Hela cells using CD168 mouse mAb (green) and negative control (red).

Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession O75330
Reactivity Human
Host Mouse
Clonality Monoclonal
Clone Names 2F2C9
Isotype IgG1
Calculated MW 84.1kDa
Description The protein encoded by this gene is involved in cell motility. It is expressed in breast tissue and together with other proteins, it forms a complex with BRCA1 and BRCA2, thus is potentially associated with higher risk of breast cancer. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Immunogen Purified recombinant fragment of human CD168 (AA: 306-497 ) expressed in E. Coli.
Formulation Purified antibody in PBS with 0.05% sodium azide
Additional Information
Other Names Hyaluronan mediated motility receptor, Intracellular hyaluronic acid-binding protein, Receptor for hyaluronan-mediated motility, CD168, HMMR, IHABP, RHAMM
Dilution E~~1/10000
WB~~1/500 - 1/2000
FC~~1/200 - 1/400
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsCD168 Antibody is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Function Involved in cell motility. When hyaluronan binds to HMMR, the phosphorylation of a number of proteins, including PTK2/FAK1 occurs. May also be involved in cellular transformation and metastasis formation, and in regulating extracellular- regulated kinase (ERK) activity.
Cellular Location Cell surface. Cytoplasm.
Tissue Location Expressed in breast cancer cell lines and in normal breast tissue EMBL; U29343; AAC52049.1; -; mRNA EMBL; AF032862; AAC32548.1; -; mRNA EMBL; AK290577; BAF83266.1; -; mRNA EMBL; AK303616; BAG64626.1; -; mRNA EMBL; AC112205; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471062; EAW61522.1; -; Genomic_DNA EMBL; CH471062; EAW61523.1; -; Genomic_DNA EMBL; CH471062; EAW61524.1; -; Genomic_DNA EMBL; CH471062; EAW61525.1; -; Genomic_DNA EMBL; BC108904; AAI08905.1; -; mRNA CCDS; CCDS4362.1; -. [O75330-1] CCDS; CCDS4363.1; -. [O75330-2] CCDS; CCDS47334.1; -. [O75330-3] CCDS; CCDS47335.1; -. [O75330-4] PIR; JC5016; JC5016 RefSeq; NP_001136028.1; NM_001142556.1. [O75330-3] RefSeq; NP_001136029.1; NM_001142557.1. [O75330-4] RefSeq; NP_036616.2; NM_012484.2. [O75330-1] RefSeq; NP_036617.2; NM_012485.2. [O75330-2] UniGene; Hs.740467; - ProteinModelPortal; O75330; - SMR; O75330; - BioGrid; 109404; 47 DIP; DIP-56496N; - IntAct; O75330; 27 MINT; MINT-4989385; - STRING; 9606.ENSP00000377492; - DrugBank; DB08818; Hyaluronic acid iPTMnet; O75330; - PhosphoSitePlus; O75330; - BioMuta; HMMR; - REPRODUCTION-2DPAGE; O75330; - EPD; O75330; - MaxQB; O75330; - PaxDb; O75330; - PeptideAtlas; O75330; - PRIDE; O75330; - Ensembl; ENST00000353866; ENSP00000185942; ENSG00000072571. [O75330-2] Ensembl; ENST00000358715; ENSP00000351554; ENSG00000072571. [O75330-1] Ensembl; ENST00000393915; ENSP00000377492; ENSG00000072571. [O75330-3] Ensembl; ENST00000432118; ENSP00000402673; ENSG00000072571. [O75330-4] GeneID; 3161; - KEGG; hsa:3161; - UCSC; uc003lzf.5; human. [O75330-1] CTD; 3161; - DisGeNET; 3161; - GeneCards; HMMR; - H-InvDB; HIX0032412; - HGNC; HGNC:5012; HMMR HPA; CAB002433; - HPA; HPA040025; - HPA; HPA043926; - MalaCards; HMMR; - MIM; 600936; gene neXtProt; NX_O75330; - OpenTargets; ENSG00000072571; - PharmGKB; PA29340; - eggNOG; ENOG410IJ28; Eukaryota eggNOG; ENOG4111G1K; LUCA GeneTree; ENSGT00390000007135; - HOVERGEN; HBG044411; - InParanoid; O75330; - KO; K06267; - OMA; NCSALME; - OrthoDB; EOG091G03MO; - PhylomeDB; O75330; - TreeFam; TF333963; - BioCyc; ZFISH:ENSG00000072571-MONOMER; - Reactome; R-HSA-2160916; Hyaluronan uptake and degradation Reactome; R-HSA-8854518; AURKA Activation by TPX2 GeneWiki; Hyaluronan-mediated_motility_receptor; - GenomeRNAi; 3161; - PRO; PR:O75330; - Proteomes; UP000005640; Chromosome 5 Bgee; ENSG00000072571; - CleanEx; HS_HMMR; - ExpressionAtlas; O75330; baseline and differential Genevisible; O75330; HS GO; GO:0009986; C:cell surface; IEA:UniProtKB-SubCell GO; GO:0005829; C:cytosol; TAS:Reactome GO; GO:0016020; C:membrane; IDA:UniProtKB GO; GO:0005886; C:plasma membrane; TAS:Reactome GO; GO:0005540; F:hyaluronic acid binding; IBA:GO_Central GO; GO:0000086; P:G2/M transition of mitotic cell cycle; TAS:Reactome GO; GO:0030214; P:hyaluronan catabolic process; TAS:Reactome InterPro; IPR031794; HMMR_C InterPro; IPR031787; HMMR_N InterPro; IPR026203; IHABP PANTHER; PTHR18956; PTHR18956; 1 Pfam; PF15908; HMMR_C; 1 Pfam; PF15905; HMMR_N; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Cytoplasm; Glycoprotein; Hyaluronic acid; Phosphoprotein; Polymorphism; Reference proteome; Repeat CHAIN 1 724 Hyaluronan mediated motility receptor /FTId=PRO_0000084007 REGION 635 645 Hyaluronic acid-binding. REGION 657 666 Hyaluronic acid-binding. MOD_RES 20 20 Phosphoserine MOD_RES 703 703 Phosphothreonine CARBOHYD 133 133 N-linked (GlcNAc...). CARBOHYD 477 477 N-linked (GlcNAc...). CARBOHYD 567 567 N-linked (GlcNAc...). CARBOHYD 588 588 N-linked (GlcNAc...). VAR_SEQ 1 90 MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKS QRFKQQKESKQNLNVDKDTTLPASARKVKSSESKESQKNDK DLKILEKE -> MTLL (in isoform 4) /FTId=VSP_041266 VAR_SEQ 75 75 K -> KK (in isoform 3) /FTId=VSP_038378 VAR_SEQ 76 90 Missing (in isoform 2) /FTId=VSP_004286 VARIANT 92 92 R -> C (in dbSNP:rs299284) /FTId=VAR_024155 VARIANT 305 305 N -> K (in dbSNP:rs2303077) /FTId=VAR_031661 VARIANT 320 320 N -> K (in dbSNP:rs2303077) /FTId=VAR_056917 VARIANT 332 332 R -> H (in dbSNP:rs2303078) /FTId=VAR_024156 VARIANT 368 368 V -> A (in dbSNP:rs299290) /FTId=VAR_020044 VARIANT 484 484 A -> V (in dbSNP:rs299295) /FTId=VAR_024157 VARIANT 557 557 D -> H (in dbSNP:rs2230362) /FTId=VAR_056918 VARIANT 595 595 L -> I (in dbSNP:rs2230363) /FTId=VAR_056919 CONFLICT 103 103 R -> S (in Ref. 2; AAC32548) CONFLICT 277 277 E -> D (in Ref. 1; AAC52049) CONFLICT 298 298 K -> T (in Ref. 1; AAC52049) CONFLICT 322 322 K -> E (in Ref. 1; AAC52049) CONFLICT 330 332 QER -> REH (in Ref. 1; AAC52049) CONFLICT 547 547 Q -> R (in Ref. 3; BAF83266) SEQUENCE 724 AA; 84100 MW; F2C3C0DBA863955F CRC64; MSFPKAPLKR FNDPSGCAPS PGAYDVKTLE VLKGPVSFQK SQRFKQQKES KQNLNVDKDT TLPASARKVK SSESKESQKN DKDLKILEKE IRVLLQERGA QDRRIQDLET ELEKMEARLN AALREKTSLS ANNATLEKQL IELTRTNELL KSKFSENGNQ KNLRILSLEL MKLRNKRETK MRGMMAKQEG MEMKLQVTQR SLEESQGKIA QLEGKLVSIE KEKIDEKSET EKLLEYIEEI SCASDQVEKY KLDIAQLEEN LKEKNDEILS LKQSLEENIV ILSKQVEDLN VKCQLLEKEK EDHVNRNREH NENLNAEMQN LKQKFILEQQ EREKLQQKEL QIDSLLQQEK ELSSSLHQKL CSFQEEMVKE KNLFEEELKQ TLDELDKLQQ KEEQAERLVK QLEEEAKSRA EELKLLEEKL KGKEAELEKS SAAHTQATLL LQEKYDSMVQ SLEDVTAQFE SYKALTASEI EDLKLENSSL QEKAAKAGKN AEDVQHQILA TESSNQEYVR MLLDLQTKSA LKETEIKEIT VSFLQKITDL QNQLKQQEED FRKQLEDEEG RKAEKENTTA ELTEEINKWR LLYEELYNKT KPFQLQLDAF EVEKQALLNE HGAAQEQLNK IRDSYAKLLG HQNLKQKIKH VVKLKDENSQ LKSEVSKLRC QLAKKKQSET KLQEELNKVL GIKHFDPSKA FHHESKENFA LKTPLKEGNT NCYRAPMECQ ESWK
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


1.PLoS One. 2013 Sep 17;8(9):e75681.2.BMC Cancer. 2011 Mar 24;11:106.

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 385.00
Cat# AO2068a
Availability: 7-10 days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions