Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   LUZP4 Antibody (N-term)   

LUZP4 Antibody (N-term)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

  • WB - LUZP4 Antibody (N-term) AP10265a
    LUZP4 Antibody (N-term) (Cat. #AP10265a) western blot analysis in 293 cell line lysates (35ug/lane).This demonstrates the LUZP4 antibody detected the LUZP4 protein (arrow).
  • IHC-P - LUZP4 Antibody (N-term) AP10265a
    LUZP4 antibody(N-term) (Cat. #AP10265a) immunohistochemistry analysis in formalin fixed and paraffin embedded human testis carcinoma followed by peroxidase conjugation of the secondary antibody and DAB staining. This data demonstrates the use of the LUZP4 antibody(N-term) for immunohistochemistry. Clinical relevance has not been evaluated.
Product Information
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
Primary Accession Q9P127
Other Accession NP_057467.1
Reactivity Human
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 33-62 aa
Additional Information
Other Names Leucine zipper protein 4, Cancer/testis antigen 28, CT-28, CT28, Tumor antigen HOM-TES-85, LUZP4
Target/Specificity This LUZP4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-62 amino acids from the N-terminal region of human LUZP4.
Dilution WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsLUZP4 Antibody (N-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name LUZP4
Function Export adapter involved in mRNA nuclear export. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NFX1 pathway). Binds NXF1, enhances its RNA-binding activity and is required for its localization to the nuclear rim. Associates with the TREX complex via its interaction with the TREX components THOC1, THOC5 and DDX39B/UAP56. Capable of complementing knockdown of ALYREF/THOC4 and partially complementing a double ALYREF/UIF knockdown in vivo. Required for the growth of the melanoma cell line MeWo (PubMed:25662211).
Cellular Location Nucleus. Cytoplasm. Note=In nuclear speckles Relocalizes to the cytoplasm during cell division
Tissue Location Expressed specifically in testis. Also expressed in a wide variety of cancer types, but particularly high levels of expression observed in melanoma cells EMBL; AF124430; AAF28870.1; -; mRNA EMBL; AK093369; BAG52698.1; -; mRNA EMBL; AL109751; CAC09922.1; -; Genomic_DNA EMBL; BC128134; AAI28135.1; -; mRNA CCDS; CCDS14567.1; -. [Q9P127-1] RefSeq; NP_001305769.1; NM_001318840.1. [Q9P127-2] RefSeq; NP_057467.1; NM_016383.4. [Q9P127-1] UniGene; Hs.242183; - ProteinModelPortal; Q9P127; - BioGrid; 119383; 91 IntAct; Q9P127; 17 STRING; 9606.ENSP00000360988; - iPTMnet; Q9P127; - PhosphoSitePlus; Q9P127; - BioMuta; LUZP4; - DMDM; 74753106; - PaxDb; Q9P127; - PeptideAtlas; Q9P127; - PRIDE; Q9P127; - Ensembl; ENST00000371920; ENSP00000360988; ENSG00000102021. [Q9P127-1] GeneID; 51213; - KEGG; hsa:51213; - UCSC; uc004eqa.4; human. [Q9P127-1] CTD; 51213; - DisGeNET; 51213; - GeneCards; LUZP4; - HGNC; HGNC:24971; LUZP4 HPA; HPA046436; - HPA; HPA051999; - MIM; 300616; gene neXtProt; NX_Q9P127; - OpenTargets; ENSG00000102021; - PharmGKB; PA134920076; - eggNOG; ENOG410IY7Q; Eukaryota eggNOG; ENOG410Z9DE; LUCA GeneTree; ENSGT00390000002455; - HOGENOM; HOG000065721; - HOVERGEN; HBG101724; - InParanoid; Q9P127; - OMA; SERSHGH; - OrthoDB; EOG091G0QN2; - PhylomeDB; Q9P127; - TreeFam; TF350091; - BioCyc; ZFISH:ENSG00000102021-MONOMER; - Reactome; R-HSA-109688; Cleavage of Growing Transcript in the Termination Region Reactome; R-HSA-159236; Transport of Mature mRNA derived from an Intron-Containing Transcript Reactome; R-HSA-72187; mRNA 3'-end processing GenomeRNAi; 51213; - PRO; PR:Q9P127; - Proteomes; UP000005640; Chromosome X Bgee; ENSG00000102021; - CleanEx; HS_LUZP4; - ExpressionAtlas; Q9P127; baseline and differential Genevisible; Q9P127; HS GO; GO:0005737; C:cytoplasm; IDA:UniProtKB GO; GO:0005634; C:nucleus; IDA:UniProtKB GO; GO:0044822; F:poly(A) RNA binding; IDA:UniProtKB GO; GO:0003697; F:single-stranded DNA binding; IDA:UniProtKB GO; GO:0003727; F:single-stranded RNA binding; IDA:UniProtKB GO; GO:0016049; P:cell growth; IMP:UniProtKB GO; GO:0006406; P:mRNA export from nucleus; IMP:UniProtKB 1: Evidence at protein level; Alternative splicing; Complete proteome; Cytoplasm; mRNA transport; Nucleus; Phosphoprotein; Polymorphism; Reference proteome; RNA-binding; Transport CHAIN 1 313 Leucine zipper protein 4 /FTId=PRO_0000288649 REGION 1 119 Interaction with DDX39B/UAP56 REGION 51 80 Arg-rich; required for RNA-binding REGION 178 236 RS-containing His-rich (RS-H); necessary for nuclear localization REGION 238 287 Leucine-zipper; required for RNA-binding and for its relocalization to the cytoplasm during cell division REGION 241 313 Interaction with NXF1 MOTIF 22 40 UAP56-binding motif (UBM); required for proper nuclear localization MOD_RES 234 234 Phosphoserine VAR_SEQ 1 32 MASFRKLTLSEKVPPNHPSRKKVNFLDMSLDD -> MLKKK RIKDRTIVKRNRLQDSNQKLIDIAIGE (in isoform 2). /FTId=VSP_053926 VAR_SEQ 33 114 Missing (in isoform 2) /FTId=VSP_053927 VARIANT 14 14 P -> S (in dbSNP:rs10482480) /FTId=VAR_051146 VARIANT 306 306 T -> A (in dbSNP:rs35314601) /FTId=VAR_051147 SEQUENCE 313 AA; 35937 MW; E041911D9BA1DC8B CRC64; MASFRKLTLS EKVPPNHPSR KKVNFLDMSL DDIIIYKELE GTNAEEEKNK RQNHSKKESP SRQQSKAHRH RHRRGYSRCR SNSEEGNHDK KPSQKPSGFK SGQHPLNGQP LIEQEKCSDN YEAQAEKNQG QSEGNQHQSE GNPDKSEESQ GQPEENHHSE RSRNHLERSL SQSDRSQGQL KRHHPQYERS HGQYKRSHGQ SERSHGHSER SHGHSERSHG HSERSHGHSK RSRSQGDLVD TQSDLIATQR DLIATQKDLI ATQRDLIATQ RDLIVTQRDL VATERDLINQ SGRSHGQSER HQRYSTGKNT ITT
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Tureci, O., et al. Oncogene 21(24):3879-3888(2002)
Sahin, U., et al. Clin. Cancer Res. 6(10):3916-3922(2000)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

Cat# AP10265a
(40 western blots)
Availability: Inquire
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Crown Flash17-30% Off
Terms & Conditions