Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Cardiovascular   >   HOPX Antibody (C-term)   

HOPX Antibody (C-term)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

     
  • WB - HOPX Antibody (C-term) AP11455b
    HOPX Antibody (C-term) (Cat. #AP11455b) western blot analysis in Ramos,A2058,293 cell line lysates (35ug/lane).This demonstrates the HOPX antibody detected the HOPX protein (arrow).
  • FC - HOPX Antibody (C-term) AP11455b
    HOPX Antibody (C-term) (Cat. #AP11455b) flow cytometric analysis of 293 cells (right histogram) compared to a negative control cell (left histogram).FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.
  • SPECIFICATION
  • CITATIONS: 1
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, FC, E
Primary Accession Q9BPY8
Other Accession NP_001138931.1, NP_631957.1, NP_115884.4
Reactivity Human
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 39-67 aa
Additional Information
Other Names Homeodomain-only protein, Lung cancer-associated Y protein, Not expressed in choriocarcinoma protein 1, Odd homeobox protein 1, HOPX, HOD, HOP, LAGY, NECC1, OB1
Target/Specificity This HOPX antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 39-67 amino acids from the C-terminal region of human HOPX.
Dilution WB~~1:1000
FC~~1:10~50
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsHOPX Antibody (C-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name HOPX
Synonyms HOD, HOP, LAGY, NECC1, OB1
Function Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy (By similarity). May act as a tumor suppressor. Acts as a co-chaperone for HSPA1A and HSPA1B chaperone proteins and assists in chaperone-mediated protein refolding (PubMed:27708256).
Cellular Location Nucleus {ECO:0000250|UniProtKB:Q8R1H0}. Cytoplasm {ECO:0000250|UniProtKB:Q8R1H0}
Tissue Location Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma EMBL; AF492675; AAM46827.1; -; mRNA EMBL; AF492676; AAM46828.1; -; mRNA EMBL; AF492677; AAM46829.1; -; mRNA EMBL; AF492678; AAM46830.1; -; mRNA EMBL; AF492679; AAM46831.1; -; mRNA EMBL; AF492680; AAM46832.1; -; mRNA EMBL; AF492681; AAM46833.1; -; mRNA EMBL; AB059408; BAB40926.1; -; mRNA EMBL; AB059409; BAB40927.1; -; mRNA EMBL; AB059410; BAB40928.1; -; mRNA EMBL; AF454763; AAL56613.1; -; mRNA EMBL; AK289707; BAF82396.1; -; mRNA EMBL; AC108215; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC014225; AAH14225.1; -; mRNA CCDS; CCDS3507.1; -. [Q9BPY8-1] CCDS; CCDS47062.1; -. [Q9BPY8-3] CCDS; CCDS54767.1; -. [Q9BPY8-4] RefSeq; NP_001138931.1; NM_001145459.1. [Q9BPY8-1] RefSeq; NP_001138932.1; NM_001145460.1. [Q9BPY8-4] RefSeq; NP_115884.4; NM_032495.5. [Q9BPY8-3] RefSeq; NP_631957.1; NM_139211.4. [Q9BPY8-1] RefSeq; NP_631958.1; NM_139212.3. [Q9BPY8-1] RefSeq; XP_016864218.1; XM_017008729.1 RefSeq; XP_016864219.1; XM_017008730.1. [Q9BPY8-1] RefSeq; XP_016864220.1; XM_017008731.1. [Q9BPY8-1] RefSeq; XP_016864221.1; XM_017008732.1. [Q9BPY8-1] RefSeq; XP_016864222.1; XM_017008733.1. [Q9BPY8-1] RefSeq; XP_016864223.1; XM_017008734.1. [Q9BPY8-1] UniGene; Hs.619396; - ProteinModelPortal; Q9BPY8; - SMR; Q9BPY8; - BioGrid; 124117; 11 IntAct; Q9BPY8; 2 STRING; 9606.ENSP00000450527; - iPTMnet; Q9BPY8; - PhosphoSitePlus; Q9BPY8; - BioMuta; HOPX; - DMDM; 60392394; - PaxDb; Q9BPY8; - PeptideAtlas; Q9BPY8; - PRIDE; Q9BPY8; - ProteomicsDB; 78595; - ProteomicsDB; 78596; -. [Q9BPY8-2] DNASU; 84525; - Ensembl; ENST00000317745; ENSP00000315198; ENSG00000171476. [Q9BPY8-1] Ensembl; ENST00000337881; ENSP00000337330; ENSG00000171476. [Q9BPY8-1] Ensembl; ENST00000381255; ENSP00000370654; ENSG00000171476. [Q9BPY8-1] Ensembl; ENST00000381260; ENSP00000370659; ENSG00000171476. [Q9BPY8-2] Ensembl; ENST00000420433; ENSP00000396275; ENSG00000171476. [Q9BPY8-3] Ensembl; ENST00000503639; ENSP00000424101; ENSG00000171476. [Q9BPY8-1] Ensembl; ENST00000508121; ENSP00000422175; ENSG00000171476. [Q9BPY8-1] Ensembl; ENST00000553379; ENSP00000452340; ENSG00000171476. [Q9BPY8-1] Ensembl; ENST00000554144; ENSP00000450527; ENSG00000171476. [Q9BPY8-4] Ensembl; ENST00000555760; ENSP00000452098; ENSG00000171476. [Q9BPY8-1] Ensembl; ENST00000556376; ENSP00000451794; ENSG00000171476. [Q9BPY8-1] Ensembl; ENST00000556614; ENSP00000452003; ENSG00000171476. [Q9BPY8-1] GeneID; 84525; - KEGG; hsa:84525; - UCSC; uc003hbz.3; human. [Q9BPY8-1] CTD; 84525; - DisGeNET; 84525; - EuPathDB; HostDB:ENSG00000171476.21; - GeneCards; HOPX; - HGNC; HGNC:24961; HOPX HPA; CAB018632; - HPA; HPA030180; - MIM; 607275; gene neXtProt; NX_Q9BPY8; - OpenTargets; ENSG00000171476; - PharmGKB; PA162391564; - eggNOG; KOG0490; Eukaryota eggNOG; ENOG410YIJ3; LUCA GeneTree; ENSGT00390000017143; - HOGENOM; HOG000112932; - HOVERGEN; HBG051921; - InParanoid; Q9BPY8; - OMA; KVSKHPD; - OrthoDB; EOG091G1BXE; - PhylomeDB; Q9BPY8; - SIGNOR; Q9BPY8; - ChiTaRS; HOPX; human GeneWiki; HOPX; - GenomeRNAi; 84525; - PRO; PR:Q9BPY8; - Proteomes; UP000005640; Chromosome 4 Bgee; ENSG00000171476; - CleanEx; HS_HOPX; - Genevisible; Q9BPY8; HS GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell GO; GO:0005634; C:nucleus; IDA:MGI GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; ISA:NTNU_SB GO; GO:0051131; P:chaperone-mediated protein complex assembly; IDA:CAFA GO; GO:0045596; P:negative regulation of cell differentiation; IDA:MGI GO; GO:0006357; P:regulation of transcription by RNA polymerase II; IBA:GO_Central GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW GO; GO:0001829; P:trophectodermal cell differentiation; IDA:MGI CDD; cd00086; homeodomain; 1 InterPro; IPR009057; Homeobox-like_sf InterPro; IPR001356; Homeobox_dom InterPro; IPR039162; HOPX PANTHER; PTHR21408; PTHR21408; 1 Pfam; PF00046; Homeobox; 1 SMART; SM00389; HOX; 1 SUPFAM; SSF46689; SSF46689; 1 PROSITE; PS50071; HOMEOBOX_2; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Cytoplasm; Developmental protein; Homeobox; Nucleus; Proto-oncogene; Reference proteome; Repressor; Transcription; Transcription regulation CHAIN 1 73 Homeodomain-only protein /FTId=PRO_0000049129 DNA_BIND 3 62 Homeobox; atypical. {ECO:0000255|PROSITE- ProRule:PRU00108} VAR_SEQ 1 1 M -> MLIFLGCYRRRLEERAGTM (in isoform 3 and isoform 4). /FTId=VSP_047290 VAR_SEQ 49 73 KWFKQRLAKWRRSEGLPSECRSVTD -> GSDLISRSKIWH PESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV (in isoform 2 and isoform 4) /FTId=VSP_012659 CONFLICT 72 72 T -> I (in Ref. 6; AAH14225) SEQUENCE 73 AA; 8260 MW; CE65E4D2A8972022 CRC64; MSAETASGPT EDQVEILEYN FNKVDKHPDS TTLCLIAAEA GLSEEETQKW FKQRLAKWRR SEGLPSECRS VTD
Research Areas
Citations ( 0 )

Background

The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq].

References

Yang, J.M., et al. Eur. J. Cell Biol. 89(7):537-546(2010)
Ooki, A., et al. Oncogene 29(22):3263-3275(2010)
Yamaguchi, S., et al. Int. J. Cancer 124(11):2577-2588(2009)
Yamashita, K., et al. Mol. Cancer Res. 6(1):31-41(2008)
De Toni, A., et al. Neural Dev 3, 13 (2008) :

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 295.00
$ 99.00
Cat# AP11455b
Size:
Quantity:
(40 western blots)
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions