Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Cell Biology   >   RNF38 Antibody (N-term)   

RNF38 Antibody (N-term)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

     
  • WB - RNF38 Antibody (N-term) AP12816a
    RNF38 Antibody (N-term) (Cat. #AP12816a) western blot analysis in HepG2 cell line lysates (35ug/lane).This demonstrates the RNF38 antibody detected the RNF38 protein (arrow).
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, E
Primary Accession Q9H0F5
Other Accession Q8BI21, NP_919311.1, NP_919313.1, NP_919310.1, NP_919309.1, NP_073618.3
Reactivity Human
Predicted Mouse
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 40-69 aa
Additional Information
Other Names E3 ubiquitin-protein ligase RNF38, 632-, RING finger protein 38, RNF38
Target/Specificity This RNF38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-69 amino acids from the N-terminal region of human RNF38.
Dilution WB~~1:1000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsRNF38 Antibody (N-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name RNF38
Function Acts as an E3 ubiquitin-protein ligase able to ubiquitinate p53/TP53 which promotes its relocalization to discrete foci associated with PML nuclear bodies. Exhibits preference for UBE2D2 as a E2 enzyme.
Cellular Location Nucleus.
Tissue Location Widely expressed with highest levels in testis. EMBL; AF394047; AAM73697.1; -; mRNA EMBL; AL136817; CAB66751.3; -; mRNA EMBL; AK024996; BAB15050.1; -; mRNA EMBL; AK093480; BAG52726.1; -; mRNA EMBL; AL161792; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL354935; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471071; EAW58305.1; -; Genomic_DNA EMBL; BC033786; AAH33786.2; -; mRNA CCDS; CCDS6603.1; -. [Q9H0F5-1] CCDS; CCDS6604.1; -. [Q9H0F5-2] RefSeq; NP_073618.3; NM_022781.4. [Q9H0F5-1] RefSeq; NP_919309.1; NM_194328.2. [Q9H0F5-3] RefSeq; NP_919310.1; NM_194329.2. [Q9H0F5-2] RefSeq; NP_919311.1; NM_194330.2. [Q9H0F5-3] RefSeq; NP_919313.1; NM_194332.2. [Q9H0F5-3] RefSeq; XP_005251423.1; XM_005251366.3. [Q9H0F5-3] RefSeq; XP_005251424.1; XM_005251367.3. [Q9H0F5-3] RefSeq; XP_005251425.1; XM_005251368.3. [Q9H0F5-3] RefSeq; XP_006716784.1; XM_006716721.3. [Q9H0F5-3] RefSeq; XP_011516014.1; XM_011517712.2. [Q9H0F5-3] RefSeq; XP_011516015.1; XM_011517713.2. [Q9H0F5-3] RefSeq; XP_016869784.1; XM_017014295.1. [Q9H0F5-3] UniGene; Hs.333503; - PDB; 1X4J; NMR; -; A=445-506 PDB; 4V3K; X-ray; 2.04 A; C/F=439-515 PDB; 4V3L; X-ray; 1.53 A; C=439-515 PDBsum; 1X4J; - PDBsum; 4V3K; - PDBsum; 4V3L; - ProteinModelPortal; Q9H0F5; - SMR; Q9H0F5; - BioGrid; 127416; 17 IntAct; Q9H0F5; 20 STRING; 9606.ENSP00000259605; - iPTMnet; Q9H0F5; - PhosphoSitePlus; Q9H0F5; - BioMuta; RNF38; - DMDM; 56749664; - PaxDb; Q9H0F5; - PeptideAtlas; Q9H0F5; - PRIDE; Q9H0F5; - ProteomicsDB; 80269; - ProteomicsDB; 80270; -. [Q9H0F5-2] ProteomicsDB; 80271; -. [Q9H0F5-3] DNASU; 152006; - Ensembl; ENST00000259605; ENSP00000259605; ENSG00000137075. [Q9H0F5-1] Ensembl; ENST00000350199; ENSP00000343947; ENSG00000137075. [Q9H0F5-3] Ensembl; ENST00000353739; ENSP00000335239; ENSG00000137075. [Q9H0F5-2] Ensembl; ENST00000357058; ENSP00000349566; ENSG00000137075. [Q9H0F5-3] Ensembl; ENST00000377877; ENSP00000367109; ENSG00000137075. [Q9H0F5-4] Ensembl; ENST00000377885; ENSP00000367117; ENSG00000137075. [Q9H0F5-3] Ensembl; ENST00000611646; ENSP00000483536; ENSG00000137075. [Q9H0F5-4] GeneID; 152006; - KEGG; hsa:152006; - UCSC; uc003zzh.5; human. [Q9H0F5-1] CTD; 152006; - EuPathDB; HostDB:ENSG00000137075.17; - GeneCards; RNF38; - HGNC; HGNC:18052; RNF38 HPA; HPA015853; - MIM; 612488; gene neXtProt; NX_Q9H0F5; - OpenTargets; ENSG00000137075; - PharmGKB; PA34438; - eggNOG; KOG0800; Eukaryota eggNOG; ENOG41121N2; LUCA GeneTree; ENSGT00730000110459; - HOGENOM; HOG000231638; - HOVERGEN; HBG059283; - InParanoid; Q9H0F5; - KO; K19041; - OMA; NQHHFSG; - OrthoDB; EOG091G09VT; - PhylomeDB; Q9H0F5; - TreeFam; TF325756; - UniPathway; UPA00143; - ChiTaRS; RNF38; human EvolutionaryTrace; Q9H0F5; - GeneWiki; RNF38; - GenomeRNAi; 152006; - PRO; PR:Q9H0F5; - Proteomes; UP000005640; Chromosome 9 Bgee; ENSG00000137075; - CleanEx; HS_RNF38; - Genevisible; Q9H0F5; HS GO; GO:0005654; C:nucleoplasm; IDA:HPA GO; GO:0005634; C:nucleus; IDA:FlyBase GO; GO:0036126; C:sperm flagellum; IEA:Ensembl GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW GO; GO:0061630; F:ubiquitin protein ligase activity; IBA:GO_Central GO; GO:0004842; F:ubiquitin-protein transferase activity; IDA:FlyBase GO; GO:0008584; P:male gonad development; IEA:Ensembl GO; GO:0043161; P:proteasome-mediated ubiquitin-dependent protein catabolic process; IBA:GO_Central GO; GO:0016567; P:protein ubiquitination; IDA:FlyBase Gene3D; 3.30.40.10; -; 1 InterPro; IPR001841; Znf_RING InterPro; IPR013083; Znf_RING/FYVE/PHD Pfam; PF13639; zf-RING_2; 1 SMART; SM00184; RING; 1 PROSITE; PS50089; ZF_RING_2; 1 1: Evidence at protein level; 3D-structure; Alternative splicing; Complete proteome; Metal-binding; Nucleus; Polymorphism; Reference proteome; Transferase; Ubl conjugation pathway; Zinc; Zinc-finger CHAIN 1 515 E3 ubiquitin-protein ligase RNF38 /FTId=PRO_0000056078 ZN_FING 463 504 RING-type. {ECO:0000255|PROSITE- ProRule:PRU00175} MOTIF 57 71 Bipartite nuclear localization signal 1 MOTIF 115 131 Bipartite nuclear localization signal 2 COMPBIAS 239 404 Pro-rich VAR_SEQ 1 183 Missing (in isoform 5) /FTId=VSP_053845 VAR_SEQ 1 83 Missing (in isoform 3) /FTId=VSP_037337 VAR_SEQ 1 44 MACKISPGANSASLPGHPNKVICERVRLQSLFPLLPSDQNT TVQ -> MQHTCTQQKKVTYKHIARFSPRNRLCQADAVFNN NLAGFQLQSP (in isoform 4) /FTId=VSP_053846 VAR_SEQ 5 54 Missing (in isoform 2) /FTId=VSP_012243 VAR_SEQ 45 120 Missing (in isoform 4) /FTId=VSP_053847 VARIANT 206 206 A -> T (in dbSNP:rs183475137) /FTId=VAR_055400 CONFLICT 308 308 I -> K (in Ref. 2; CAB66751) CONFLICT 421 421 E -> G (in Ref. 3; BAG52726) HELIX 441 445 {ECO:0000244|PDB:4V3K} STRAND 448 450 {ECO:0000244|PDB:4V3L} STRAND 453 455 {ECO:0000244|PDB:1X4J} STRAND 457 459 {ECO:0000244|PDB:4V3L} TURN 464 467 {ECO:0000244|PDB:4V3L} STRAND 475 478 {ECO:0000244|PDB:4V3L} TURN 480 482 {ECO:0000244|PDB:1X4J} STRAND 484 486 {ECO:0000244|PDB:4V3L} HELIX 487 496 {ECO:0000244|PDB:4V3L} TURN 501 503 {ECO:0000244|PDB:4V3L} SEQUENCE 515 AA; 57595 MW; ABFE9486CA732AFA CRC64; MACKISPGAN SASLPGHPNK VICERVRLQS LFPLLPSDQN TTVQEDAHFK AFFQSEDSPS PKRQRLSHSV FDYTSASPAP SPPMRPWEMT SNRQPPSVRP SQHHFSGERC NTPARNRRSP PVRRQRGRRD RLSRHNSISQ DENYHHLPYA QQQAIEEPRA FHPPNVSPRL LHPAAHPPQQ NAVMVDIHDQ LHQGTVPVSY TVTTVAPHGI PLCTGQHIPA CSTQQVPGCS VVFSGQHLPV CSVPPPMLQA CSVQHLPVPY AAFPPLISSD PFLIHPPHLS PHHPPHLPPP GQFVPFQTQQ SRSPLQRIEN EVELLGEHLP VGGFTYPPSA HPPTLPPSAP LQFLTHDPLH QEVSFGVPYP PFMPRRLTGR SRYRSQQPIP PPPYHPSLLP YVLSMLPVPP AVGPTFSFEL DVEDGEVENY EALLNLAERL GEAKPRGLTK ADIEQLPSYR FNPNNHQSEQ TLCVVCMCDF ESRQLLRVLP CNHEFHAKCV DKWLKANRTC PICRADASEV HRDSE
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

This gene encodes a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.

References

Humphray, S.J., et al. Nature 429(6990):369-374(2004)
Eisenberg, I., et al. Biochem. Biophys. Res. Commun. 294(5):1169-1176(2002)

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 295.00
$ 99.00
Cat# AP12816a
Size:
Quantity:
(40 western blots)
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions