Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   PLP2 Antibody (C-term)   

PLP2 Antibody (C-term)

Purified Rabbit Polyclonal Antibody (Pab)

     
  • WB - PLP2 Antibody (C-term) AP21491b
    Anti-PLP2 Antibody (C-term)at 1:2000 dilution + SW480 whole cell lysates Lysates/proteins at 20 µg per lane. Secondary Goat Anti-Rabbit IgG, (H+L), Peroxidase conjugated at 1/10000 dilution Predicted band size : 17 kDa Blocking/Dilution buffer: 5% NFDM/TBST.
  • WB - PLP2 Antibody (C-term) AP21491b
    Anti-PLP2 Antibody (C-term)at 1:2000 dilution + PC-3 whole cell lysates Lysates/proteins at 20 µg per lane. Secondary Goat Anti-Rabbit IgG, (H+L), Peroxidase conjugated at 1/10000 dilution Predicted band size : 17 kDa Blocking/Dilution buffer: 5% NFDM/TBST.
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, E
Primary Accession Q04941
Reactivity Human
Host Rabbit
Clonality polyclonal
Isotype Rabbit Ig
Additional Information
Other Names Proteolipid protein 2, Differentiation-dependent protein A4, Intestinal membrane A4 protein, PLP2, A4
Target/Specificity This PLP2 antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 133-166 amino acids from the C-terminal region of human PLP2.
Dilution WB~~1:2000
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsPLP2 Antibody (C-term) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name PLP2
Synonyms A4
Function May play a role in cell differentiation in the intestinal epithelium.
Cellular Location Membrane; Multi-pass membrane protein.
Tissue Location Enriched in colonic mucosa. The expression of A4 follows a gradient along the crypto-villus axis with the most abundant message occurring in the lower half of the crypt EMBL; L09604; AAA35499.1; -; mRNA EMBL; U93305; AAB92356.1; -; Genomic_DNA EMBL; DB102321; -; NOT_ANNOTATED_CDS; mRNA EMBL; AF196779; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC109066; AAI09067.1; -; mRNA CCDS; CCDS14319.1; -. [Q04941-1] PIR; S32567; S32567 RefSeq; NP_002659.1; NM_002668.2. [Q04941-1] UniGene; Hs.77422; - ProteinModelPortal; Q04941; - BioGrid; 111369; 30 IntAct; Q04941; 64 STRING; 9606.ENSP00000365505; - TCDB; 1.A.64.5.2; the plasmolipin (plasmolipin) family iPTMnet; Q04941; - PhosphoSitePlus; Q04941; - SwissPalm; Q04941; - BioMuta; PLP2; - DMDM; 416563; - EPD; Q04941; - MaxQB; Q04941; - PaxDb; Q04941; - PeptideAtlas; Q04941; - PRIDE; Q04941; - ProteomicsDB; 58301; - ProteomicsDB; 58302; -. [Q04941-2] TopDownProteomics; Q04941-1; -. [Q04941-1] Ensembl; ENST00000376322; ENSP00000365500; ENSG00000102007. [Q04941-2] Ensembl; ENST00000376327; ENSP00000365505; ENSG00000102007. [Q04941-1] GeneID; 5355; - KEGG; hsa:5355; - UCSC; uc004dmx.4; human. [Q04941-1] CTD; 5355; - DisGeNET; 5355; - EuPathDB; HostDB:ENSG00000102007.10; - GeneCards; PLP2; - HGNC; HGNC:9087; PLP2 HPA; HPA042415; - MIM; 300112; gene neXtProt; NX_Q04941; - OpenTargets; ENSG00000102007; - PharmGKB; PA33415; - eggNOG; KOG4788; Eukaryota eggNOG; ENOG4111IAF; LUCA GeneTree; ENSGT00530000063326; - HOGENOM; HOG000293179; - HOVERGEN; HBG099247; - InParanoid; Q04941; - OMA; IYMCDLH; - OrthoDB; EOG091G0SSY; - PhylomeDB; Q04941; - TreeFam; TF317387; - ChiTaRS; PLP2; human GeneWiki; PLP2; - GenomeRNAi; 5355; - PRO; PR:Q04941; - Proteomes; UP000005640; Chromosome X Bgee; ENSG00000102007; - CleanEx; HS_PLP2; - ExpressionAtlas; Q04941; baseline and differential Genevisible; Q04941; HS GO; GO:0005783; C:endoplasmic reticulum; TAS:ProtInc GO; GO:0005789; C:endoplasmic reticulum membrane; TAS:ProtInc GO; GO:0016021; C:integral component of membrane; IBA:GO_Central GO; GO:0016020; C:membrane; TAS:ProtInc GO; GO:0005886; C:plasma membrane; IDA:UniProtKB GO; GO:0019956; F:chemokine binding; IPI:UniProtKB GO; GO:0015075; F:ion transmembrane transporter activity; TAS:ProtInc GO; GO:0006935; P:chemotaxis; NAS:UniProtKB GO; GO:0019221; P:cytokine-mediated signaling pathway; NAS:UniProtKB GO; GO:0006811; P:ion transport; TAS:ProtInc InterPro; IPR008253; Marvel Pfam; PF01284; MARVEL; 1 PROSITE; PS51225; MARVEL; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Glycoprotein; Membrane; Polymorphism; Reference proteome; Transmembrane; Transmembrane helix CHAIN 1 152 Proteolipid protein 2 /FTId=PRO_0000156819 TRANSMEM 25 45 Helical. TRANSMEM 48 68 Helical. TRANSMEM 85 105 Helical. TRANSMEM 112 132 Helical. DOMAIN 19 137 MARVEL. {ECO:0000255|PROSITE- ProRule:PRU00581} CARBOHYD 18 18 N-linked (GlcNAc...) asparagine CARBOHYD 108 108 N-linked (GlcNAc...) asparagine VAR_SEQ 117 152 LGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV -> K AMGAALKHRAKGLRSQGPFLPLLLAEIV (in isoform 2). /FTId=VSP_041602 VARIANT 91 91 A -> S (in dbSNP:rs1802969) /FTId=VAR_011924 SEQUENCE 152 AA; 16691 MW; 689378A8C326206C CRC64; MADSERLSAP GCWAACTNFS RTRKGILLFA EIILCLVILI CFSASTPGYS SLSVIEMILA AIFFVVYMCD LHTKIPFINW PWSDFFRTLI AAILYLITSI VVLVERGNHS KIVAGVLGLI ATCLFGYDAY VTFPVRQPRH TAAPTDPADG PV
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

May play a role in cell differentiation in the intestinal epithelium.

References

Oliva M.M.,et al.Arch. Biochem. Biophys. 302:183-192(1993).
Fisher S.E.,et al.Genomics 45:340-347(1997).
Kimura K.,et al.Genome Res. 16:55-65(2006).
Ross M.T.,et al.Nature 434:325-337(2005).
Burkard T.R.,et al.BMC Syst. Biol. 5:17-17(2011).

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 99.00
Cat# AP21491b
Size:
Quantity:
(40 western blots)
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions