Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Signal Transduction   >   Arhgef9 Antibody (Center)   

Arhgef9 Antibody (Center)

Peptide Affinity Purified Rabbit Polyclonal Antibody (Pab)

     
  • WB - Arhgef9 Antibody (Center) AP2713c
    All lanes : Anti-Collybistin(Arhgef9) (Center) at 1:1000 dilution Lane 1: rat brain lysate Lane 2: rat heart lysate Lysates/proteins at 20 µg per lane. Secondary Goat Anti-Rabbit IgG, (H+L), Peroxidase conjugated at 1/10000 dilution. Predicted band size : 58 kDa Blocking/Dilution buffer: 5% NFDM/TBST.
  • IHC-P - Arhgef9 Antibody (Center) AP2713c
    Formalin-fixed and paraffin-embedded human brain tissue reacted with Arhgef9 Antibody (Center) (Cat.#AP2713c), which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P, E
Primary Accession Q9QX73
Other Accession Q3UTH8, O43307, Q58DL7
Reactivity Rat
Predicted Human, Mouse
Host Rabbit
Clonality Polyclonal
Isotype Rabbit Ig
Antigen Region 274-303 aa
Additional Information
Other Names Rho guanine nucleotide exchange factor 9, Collybistin, Rac/Cdc42 guanine nucleotide exchange factor 9, Arhgef9
Target/Specificity This Arhgef9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-303 amino acids from the Central region of human Arhgef9.
Dilution WB~~1:1000
IHC-P~~1:10~50
Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification.
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
PrecautionsArhgef9 Antibody (Center) is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name Arhgef9
Function Acts as guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters.
Cellular Location Cytoplasm
Tissue Location Detected in brain, throughout the gray matter. Detected at low levels in heart and skeletal muscle EMBL; AJ250425; CAB65966.1; -; mRNA EMBL; AJ302676; CAC16410.1; -; mRNA RefSeq; NP_076447.1; NM_023957.1. [Q9QX73-1] UniGene; Rn.163449; - PDB; 2DFK; X-ray; 2.15 A; A/C=71-463 PDB; 4MT6; X-ray; 5.50 A; A=1-456 PDB; 4MT7; X-ray; 3.50 A; A=10-493 PDBsum; 2DFK; - PDBsum; 4MT6; - PDBsum; 4MT7; - ProteinModelPortal; Q9QX73; - SMR; Q9QX73; - STRING; 10116.ENSRNOP00000061089; - PhosphoSitePlus; Q9QX73; - PaxDb; Q9QX73; - PRIDE; Q9QX73; - GeneID; 66013; - KEGG; rno:66013; - CTD; 23229; - RGD; 620719; Arhgef9 eggNOG; KOG3519; Eukaryota eggNOG; ENOG410XT9S; LUCA HOGENOM; HOG000237363; - HOVERGEN; HBG050568; - InParanoid; Q9QX73; - KO; K20686; - PhylomeDB; Q9QX73; - EvolutionaryTrace; Q9QX73; - PRO; PR:Q9QX73; - Proteomes; UP000002494; Unplaced GO; GO:0005938; C:cell cortex; IDA:RGD GO; GO:0005886; C:plasma membrane; IEA:GOC GO; GO:0005089; F:Rho guanyl-nucleotide exchange factor activity; IEA:InterPro GO; GO:0043113; P:receptor clustering; IDA:RGD GO; GO:0035023; P:regulation of Rho protein signal transduction; IEA:InterPro CDD; cd00160; RhoGEF; 1 CDD; cd11975; SH3_ARHGEF9; 1 Gene3D; 1.20.900.10; -; 1 Gene3D; 2.30.29.30; -; 1 InterPro; IPR035728; ARHGEF9_SH3 InterPro; IPR035899; DBL_dom_sf InterPro; IPR000219; DH-domain InterPro; IPR011993; PH-like_dom_sf InterPro; IPR001849; PH_domain InterPro; IPR036028; SH3-like_dom_sf InterPro; IPR001452; SH3_domain Pfam; PF00169; PH; 1 Pfam; PF00621; RhoGEF; 1 Pfam; PF00018; SH3_1; 1 SMART; SM00233; PH; 1 SMART; SM00325; RhoGEF; 1 SMART; SM00326; SH3; 1 SUPFAM; SSF48065; SSF48065; 1 SUPFAM; SSF50044; SSF50044; 1 PROSITE; PS50010; DH_2; 1 PROSITE; PS50003; PH_DOMAIN; 1 PROSITE; PS50002; SH3; 1 1: Evidence at protein level; 3D-structure; Alternative splicing; Complete proteome; Cytoplasm; Guanine-nucleotide releasing factor; Reference proteome; SH3 domain CHAIN 1 493 Rho guanine nucleotide exchange factor 9 /FTId=PRO_0000253898 DOMAIN 15 74 SH3. {ECO:0000255|PROSITE- ProRule:PRU00192} DOMAIN 110 294 DH. {ECO:0000255|PROSITE- ProRule:PRU00062} DOMAIN 325 432 PH. {ECO:0000255|PROSITE- ProRule:PRU00145} REGION 107 117 Interaction with GPHN VAR_SEQ 12 71 Missing (in isoform 2) /FTId=VSP_021147 VAR_SEQ 464 493 GRVGEEENQSLELKRACEVLQRLWSPGKKS -> VTQRKWH Y (in isoform 2) /FTId=VSP_021148 MUTAGEN 107 107 R->A: No effect on formation of GPHN clusters; when associated with A-108 and A-117. MUTAGEN 108 108 D->A: No effect on GPHN clusters; when associated with A-107 and A-117 MUTAGEN 111 111 R->A: Loss of formation of GPHN clusters MUTAGEN 117 117 E->A: No effect on GPHN clusters; when associated with A-107 and A-108 MUTAGEN 297 297 R->H: Defects in binding to phosphatidylinositol-3-phosphate and in formation of GPHN clusters HELIX 107 135 {ECO:0000244|PDB:2DFK} HELIX 137 142 {ECO:0000244|PDB:2DFK} TURN 144 146 {ECO:0000244|PDB:2DFK} HELIX 149 156 {ECO:0000244|PDB:2DFK} HELIX 159 176 {ECO:0000244|PDB:2DFK} HELIX 182 184 {ECO:0000244|PDB:2DFK} HELIX 188 193 {ECO:0000244|PDB:2DFK} TURN 194 196 {ECO:0000244|PDB:2DFK} HELIX 197 199 {ECO:0000244|PDB:2DFK} HELIX 200 218 {ECO:0000244|PDB:2DFK} HELIX 222 234 {ECO:0000244|PDB:2DFK} HELIX 242 246 {ECO:0000244|PDB:2DFK} HELIX 248 265 {ECO:0000244|PDB:2DFK} HELIX 274 299 {ECO:0000244|PDB:2DFK} HELIX 301 310 {ECO:0000244|PDB:2DFK} STRAND 311 313 {ECO:0000244|PDB:4MT7} HELIX 319 321 {ECO:0000244|PDB:2DFK} STRAND 326 337 {ECO:0000244|PDB:2DFK} STRAND 343 350 {ECO:0000244|PDB:2DFK} STRAND 353 359 {ECO:0000244|PDB:2DFK} STRAND 367 374 {ECO:0000244|PDB:2DFK} HELIX 375 377 {ECO:0000244|PDB:2DFK} STRAND 378 382 {ECO:0000244|PDB:2DFK} STRAND 385 387 {ECO:0000244|PDB:2DFK} STRAND 389 391 {ECO:0000244|PDB:2DFK} STRAND 394 407 {ECO:0000244|PDB:2DFK} STRAND 409 413 {ECO:0000244|PDB:2DFK} HELIX 417 440 {ECO:0000244|PDB:2DFK} HELIX 446 458 {ECO:0000244|PDB:2DFK} SEQUENCE 493 AA; 58157 MW; 41040671B9398BFA CRC64; MQWIRGGSGM LITGDSIVSA EAVWDHVTMA NRGVAFKAGD VIKVLDASNK DWWWGQIDDE EGWFPASFVR LWVNQEDGVE EGPSDVQNGH LDPNSDCLCL GRPLQNRDQM RANVINEIMS TERHYIKHLK DICEGYLKQC RKRRDMFSDE QLKVIFGNIE DIYRFQMGFV RDLEKQYNND DPHLSEIGPC FLEHQDGFWI YSEYCNNHLD ACMELSKLMK DSRYQHFFEA CRLLQQMIDI AIDGFLLTPV QKICKYPLQL AELLKYTAQD HSDYRYVAAA LAVMRNVTQQ INERKRRLEN IDKIAQWQAS VLDWEGDDIL DRSSELIYTG EMAWIYQPYG RNQQRVFFLF DHQMVLCKKD LIRRDILYYK GRIDMDKYEV IDIEDGRDDD FNVSMKNAFK LHNKETEEVH LFFAKKLEEK IRWLRAFREE RKMVQEDEKI GFEISENQKR QAAMTVRKAS KQKGRVGEEE NQSLELKRAC EVLQRLWSPG KKS
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

ARHGEF9 belongs to a family of Rho-like GTPases that act as molecular switches by cycling from the active GTP-bound state to the inactive GDP-bound state. These proteins are key regulators of the actin cytoskeleton and are involved in cell signaling.

References

Xiang,S., J. Mol. Biol. 359 (1), 35-46 (2006)
Harvey,K., J. Neurosci. 24 (25), 5816-5826 (2004)
Grosskreutz,Y., Biol. Chem. 382 (10), 1455-1462 (2001)
Kins,S., Nat. Neurosci. 3 (1), 22-29 (2000)

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 295.00
$ 99.00
Cat# AP2713c
Size:
Quantity:
(40 western blots)
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions