Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   FIBCD1 Antibody (N-term) Blocking peptide   

FIBCD1 Antibody (N-term) Blocking peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession Q8N539
Other Accession NP_001138578.1, NP_116232.3
Clone Names 100111083
Peptide ID 100111083
Additional Information
Other Names Fibrinogen C domain-containing protein 1, FIBCD1
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name FIBCD1
Function Acetyl group-binding receptor which shows a high- affinity and calcium-dependent binding to acetylated structures such as chitin, some N-acetylated carbohydrates, and amino acids, but not to their non-acetylated counterparts. Can facilitate the endocytosis of acetylated components.
Cellular Location Membrane; Single-pass type II membrane protein
Tissue Location Expressed in the small and large intestinal epithelial cells with a highly polarized localization to the apical surface corresponding to the brush border and in the ducts of the salivary gland. EMBL; AY358311; AAQ88678.1; -; mRNA EMBL; AK027716; BAB55319.1; -; mRNA EMBL; AL161733; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC032953; AAH32953.1; -; mRNA CCDS; CCDS6937.1; -. [Q8N539-1] RefSeq; NP_001138578.1; NM_001145106.1. [Q8N539-1] RefSeq; NP_116232.3; NM_032843.4. [Q8N539-1] UniGene; Hs.133205; - PDB; 4M7F; X-ray; 2.10 A; A/B=236-461 PDB; 4M7H; X-ray; 2.00 A; A/B=236-461 PDBsum; 4M7F; - PDBsum; 4M7H; - ProteinModelPortal; Q8N539; - SMR; Q8N539; - BioGrid; 124363; 1 IntAct; Q8N539; 1 STRING; 9606.ENSP00000361413; - iPTMnet; Q8N539; - PhosphoSitePlus; Q8N539; - BioMuta; FIBCD1; - DMDM; 152032456; - PaxDb; Q8N539; - PeptideAtlas; Q8N539; - PRIDE; Q8N539; - ProteomicsDB; 71998; - ProteomicsDB; 71999; -. [Q8N539-2] Ensembl; ENST00000372338; ENSP00000361413; ENSG00000130720. [Q8N539-1] Ensembl; ENST00000448616; ENSP00000414501; ENSG00000130720. [Q8N539-1] GeneID; 84929; - KEGG; hsa:84929; - UCSC; uc004bzz.4; human. [Q8N539-1] CTD; 84929; - EuPathDB; HostDB:ENSG00000130720.12; - GeneCards; FIBCD1; - H-InvDB; HIX0008476; - HGNC; HGNC:25922; FIBCD1 HPA; HPA053898; - HPA; HPA055353; - MIM; 613357; gene neXtProt; NX_Q8N539; - OpenTargets; ENSG00000130720; - PharmGKB; PA134891641; - eggNOG; KOG2579; Eukaryota eggNOG; ENOG410ZYS4; LUCA GeneTree; ENSGT00920000148944; - HOGENOM; HOG000037127; - HOVERGEN; HBG001644; - InParanoid; Q8N539; - OMA; QRPSCGY; - OrthoDB; EOG091G03M1; - PhylomeDB; Q8N539; - TreeFam; TF351983; - ChiTaRS; FIBCD1; human GenomeRNAi; 84929; - PRO; PR:Q8N539; - Proteomes; UP000005640; Chromosome 9 Bgee; ENSG00000130720; - CleanEx; HS_FIBCD1; - ExpressionAtlas; Q8N539; baseline and differential Genevisible; Q8N539; HS GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW GO; GO:0016020; C:membrane; IDA:UniProtKB GO; GO:0008061; F:chitin binding; IDA:UniProtKB GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW CDD; cd00087; FReD; 1 Gene3D; 3.90.215.10; -; 2 Gene3D; 4.10.530.10; -; 1 InterPro; IPR036056; Fibrinogen-like_C InterPro; IPR014716; Fibrinogen_a/b/g_C_1 InterPro; IPR014715; Fibrinogen_a/b/g_C_2 InterPro; IPR002181; Fibrinogen_a/b/g_C_dom InterPro; IPR020837; Fibrinogen_CS Pfam; PF00147; Fibrinogen_C; 1 SMART; SM00186; FBG; 1 SUPFAM; SSF56496; SSF56496; 1 PROSITE; PS00514; FIBRINOGEN_C_1; 1 PROSITE; PS51406; FIBRINOGEN_C_2; 1 1: Evidence at protein level; 3D-structure; Alternative splicing; Calcium; Chitin-binding; Complete proteome; Disulfide bond; Glycoprotein; Membrane; Metal-binding; Reference proteome; Signal-anchor; Transmembrane; Transmembrane helix CHAIN 1 461 Fibrinogen C domain-containing protein 1 /FTId=PRO_0000294315 TOPO_DOM 1 33 Cytoplasmic. TRANSMEM 34 54 Helical; Signal-anchor for type II membrane protein. TOPO_DOM 55 461 Extracellular. DOMAIN 235 458 Fibrinogen C-terminal {ECO:0000255|PROSITE-ProRule:PRU00739} METAL 393 393 Calcium. METAL 395 395 Calcium. SITE 405 405 Implicated in ligand binding SITE 415 415 Implicated in ligand binding SITE 431 431 Implicated in ligand binding SITE 432 432 Implicated in ligand binding CARBOHYD 340 340 N-linked (GlcNAc...) asparagine DISULFID 244 273 {ECO:0000255|PROSITE-ProRule:PRU00739} DISULFID 401 414 {ECO:0000255|PROSITE-ProRule:PRU00739} VAR_SEQ 1 158 Missing (in isoform 2) /FTId=VSP_026618 VAR_SEQ 317 357 LKRIHALTTQAAYELHVDLEDFENGTAYARYGSFGVGLFSV -> PLDRCTLSLALLVPVAPSPTPPHSFVNVLHPPVPGGPT LQ (in isoform 2) /FTId=VSP_026619 VAR_SEQ 358 461 Missing (in isoform 2) /FTId=VSP_026620 MUTAGEN 393 393 D->N: Complete loss of binding to acetylated bovine serum albumin and reduced binding to chitin; when associated with A-395 MUTAGEN 395 395 D->A: Complete loss of binding to acetylated bovine serum albumin and reduced binding to chitin; when associated with N-395 MUTAGEN 405 405 Y->S: Significantly reduced binding to acetylated bovine serum albumin and loss of binding to chitin; when associated with S-431 MUTAGEN 415 415 H->G: Complete loss of binding to acetylated bovine serum albumin and chitin. MUTAGEN 431 431 Y->S: Significantly reduced binding to acetylated bovine serum albumin and loss of binding to chitin; when associated with S-405 MUTAGEN 432 432 A->V: Complete loss of binding to acetylated bovine serum albumin and chitin. MUTAGEN 443 443 W->S: Slight reduction in binding to acetylated bovine serum albumin and no effect on binding to chitin CONFLICT 79 79 L -> V (in Ref. 4; AAH32953) HELIX 244 249 {ECO:0000244|PDB:4M7H} STRAND 256 260 {ECO:0000244|PDB:4M7H} STRAND 269 274 {ECO:0000244|PDB:4M7H} HELIX 277 279 {ECO:0000244|PDB:4M7H} STRAND 282 291 {ECO:0000244|PDB:4M7H} HELIX 299 304 {ECO:0000244|PDB:4M7H} STRAND 311 314 {ECO:0000244|PDB:4M7H} HELIX 317 324 {ECO:0000244|PDB:4M7H} STRAND 329 336 {ECO:0000244|PDB:4M7H} STRAND 342 353 {ECO:0000244|PDB:4M7H} TURN 359 363 {ECO:0000244|PDB:4M7H} STRAND 366 375 {ECO:0000244|PDB:4M7H} HELIX 380 382 {ECO:0000244|PDB:4M7H} STRAND 395 399 {ECO:0000244|PDB:4M7H} HELIX 401 404 {ECO:0000244|PDB:4M7H} STRAND 412 414 {ECO:0000244|PDB:4M7H} STRAND 416 418 {ECO:0000244|PDB:4M7H} STRAND 429 432 {ECO:0000244|PDB:4M7H} STRAND 434 437 {ECO:0000244|PDB:4M7H} HELIX 438 441 {ECO:0000244|PDB:4M7H} STRAND 443 446 {ECO:0000244|PDB:4M7H} STRAND 448 456 {ECO:0000244|PDB:4M7H} SEQUENCE 461 AA; 50744 MW; B217DBFD370A3443 CRC64; MVNDRWKTMG GAAQLEDRPR DKPQRPSCGY VLCTVLLALA VLLAVAVTGA VLFLNHAHAP GTAPPPVVST GAASANSALV TVERADSSHL SILIDPRCPD LTDSFARLES AQASVLQALT EHQAQPRLVG DQEQELLDTL ADQLPRLLAR ASELQTECMG LRKGHGTLGQ GLSALQSEQG RLIQLLSESQ GHMAHLVNSV SDILDALQRD RGLGRPRNKA DLQRAPARGT RPRGCATGSR PRDCLDVLLS GQQDDGVYSV FPTHYPAGFQ VYCDMRTDGG GWTVFQRRED GSVNFFRGWD AYRDGFGRLT GEHWLGLKRI HALTTQAAYE LHVDLEDFEN GTAYARYGSF GVGLFSVDPE EDGYPLTVAD YSGTAGDSLL KHSGMRFTTK DRDSDHSENN CAAFYRGAWW YRNCHTSNLN GQYLRGAHAS YADGVEWSSW TGWQYSLKFS EMKIRPVRED R
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

FIBCD1 is a conserved type II transmembrane endocyticreceptor that binds chitin and is located primarily in theintestinal brush border (Schlosser et al., 2009 [PubMed19710473]).

References

Davila, S., et al. Genes Immun. 11(3):232-238(2010)Thomsen, T., et al. J. Biol. Chem. 285(2):1229-1238(2010)Schlosser, A., et al. J. Immunol. 183(6):3800-3809(2009)Clark, H.F., et al. Genome Res. 13(10):2265-2270(2003)

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 80.00
Cat# BP10324a
Size:
Quantity:
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions