Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   C13orf33 Antibody (Center) Blocking peptide   

C13orf33 Antibody (Center) Blocking peptide

Synthetic peptide

Product Information
Primary Accession Q5VYS4
Other Accession NP_116238.2
Clone Names 91218296
Peptide ID 91218296
Additional Information
Other Names Mesenteric estrogen-dependent adipogenesis protein, Activated in W/Wv mouse stomach 3 homolog, hAWMS3, Mesenteric estrogen-dependent adipose 4, MEDA-4, MEDAG, AWMS3, C13orf33, MEDA4
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Synonyms AWMS3, C13orf33, MEDA4
Function Involved in processes that promote adipocyte differentiation, lipid accumulation, and glucose uptake in mature adipocytes.
Cellular Location Cytoplasm.
Tissue Location Highly expressed in the visceral fat depot. EMBL; AK027740; -; NOT_ANNOTATED_CDS; mRNA EMBL; AK055635; BAB70975.1; -; mRNA EMBL; AL353680; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC040165; AAH40165.1; -; mRNA EMBL; BC101624; AAI01625.1; -; mRNA EMBL; BC101626; AAI01627.1; -; mRNA EMBL; AB055407; BAC53805.1; -; mRNA CCDS; CCDS9338.1; -. [Q5VYS4-1] RefSeq; NP_116238.2; NM_032849.3 UniGene; Hs.147880; - UniGene; Hs.708377; - ProteinModelPortal; Q5VYS4; - IntAct; Q5VYS4; 5 iPTMnet; Q5VYS4; - PhosphoSitePlus; Q5VYS4; - BioMuta; MEDAG; - PaxDb; Q5VYS4; - PeptideAtlas; Q5VYS4; - PRIDE; Q5VYS4; - ProteomicsDB; 65640; - ProteomicsDB; 65641; -. [Q5VYS4-2] DNASU; 84935; - Ensembl; ENST00000380482; ENSP00000369849; ENSG00000102802. [Q5VYS4-1] GeneID; 84935; - KEGG; hsa:84935; - UCSC; uc001uth.5; human. [Q5VYS4-1] CTD; 84935; - EuPathDB; HostDB:ENSG00000102802.9; - GeneCards; MEDAG; - HGNC; HGNC:25926; MEDAG neXtProt; NX_Q5VYS4; - OpenTargets; ENSG00000102802; - PharmGKB; PA147358556; - eggNOG; ENOG410IKGJ; Eukaryota eggNOG; ENOG411208I; LUCA GeneTree; ENSGT00390000018451; - HOGENOM; HOG000111804; - HOVERGEN; HBG081258; - InParanoid; Q5VYS4; - OMA; DDVFNCN; - OrthoDB; EOG091G0IZY; - PhylomeDB; Q5VYS4; - TreeFam; TF328824; - GenomeRNAi; 84935; - PRO; PR:Q5VYS4; - Proteomes; UP000005640; Chromosome 13 Bgee; ENSG00000102802; - CleanEx; HS_C13orf33; - ExpressionAtlas; Q5VYS4; baseline and differential Genevisible; Q5VYS4; HS GO; GO:0005737; C:cytoplasm; IDA:UniProtKB GO; GO:0045600; P:positive regulation of fat cell differentiation; ISS:UniProtKB InterPro; IPR039230; MEDAG PANTHER; PTHR33769:SF3; PTHR33769:SF3; 1 2: Evidence at transcript level; Alternative splicing; Complete proteome; Cytoplasm; Polymorphism; Reference proteome CHAIN 1 303 Mesenteric estrogen-dependent adipogenesis protein /FTId=PRO_0000274333 VAR_SEQ 1 114 Missing (in isoform 2) /FTId=VSP_022714 VAR_SEQ 223 262 NLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSR -> L (in isoform 2) /FTId=VSP_022715 VARIANT 59 59 R -> G (in dbSNP:rs9531945) /FTId=VAR_030261 SEQUENCE 303 AA; 34190 MW; AAE14F897EA2C484 CRC64; MAGAACEPVA RPSLTSISSG ELRSLWTCDC ELALLPLAQL LRLQPGAFQL SGDQLVVARP GEPAAARGGF NVFGDGLVRL DGQLYRLSSY IKRYVELTNY CDYKDYRETI LSKPMLFFIN VQTKKDTSKE RTYAFLVNTR HPKIRRQIEQ GMDMVISSVI GESYRLQFDF QEAVKNFFPP GNEVVNGENL SFAYEFKADA LFDFFYWFGL SNSVVKVNGK VLNLSSTSPE KKETIKLFLE KMSEPLIRRS SFSDRKFSVT SRGSIDDVFN CNLSPRSSLT EPLLAELPFP SVLESEETPN QFI
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Lamesch, P., et al. Genomics 89(3):307-315(2007)Dunham, A., et al. Nature 428(6982):522-528(2004)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 80.00
Cat# BP10408c
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions