Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   LILRA2 Antibody (Center) Blocking Peptide   

LILRA2 Antibody (Center) Blocking Peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession Q8N149
Other Accession NP_006857.1, NP_001124389.1
Clone Names 90713127
Peptide ID 90713127
Additional Information
Other Names Leukocyte immunoglobulin-like receptor subfamily A member 2, CD85 antigen-like family member H, Immunoglobulin-like transcript 1, ILT-1, Leukocyte immunoglobulin-like receptor 7, LIR-7, CD85h, LILRA2, ILT1, LIR7
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name LILRA2
Synonyms ILT1, LIR7
Function Part of the innate immune responses against microbial infection (PubMed:12529506, PubMed:27572839). Specifically recognizes a set of N-terminally truncated immunoglobulins that are produced via cleavage by proteases from a range of pathogenic bacteria and fungi, including L.pneumophila, M.hyorhinis, S.pneumoniae, S.aureus and C.albicans (PubMed:27572839). Recognizes epitopes that are in part in the variable region of the immunoglobulin light chains, but requires also the constant region for signaling (PubMed:27572839). Binds to a subset of cleaved IgM, IgG3 and IgG4 molecules, but does not bind cleaved IgA1 (PubMed:27572839). Binding of N-terminally truncated immunoglobulins mediates activation of neutrophils (PubMed:27572839). In monocytes, activation leads to the release of CSF2, CF3, IL6, CXCL8 and CCL3 and down-regulates responses to bacterial lipopolysaccharide (LPS), possibly via down-regulation of TLR4 expression and reduced signaling via TLR4 (PubMed:22479404). In eosinophils, activation by ligand binding leads to the release of RNASE2, IL4 and leukotriene C4 (PubMed:12529506). Does not bind class I MHC antigens (PubMed:19230061).
Cellular Location Cell membrane; Single- pass type I membrane protein
Tissue Location Detected on the surface of all peripheral blood monocytes, neutrophils, basophils and eosinophils (at protein level) (PubMed:12529506, PubMed:22479404). Expression levels are very low or not detectable on monocytes, T-cells, B- cells, dendritic cells and natural killer (NK) cells (PubMed:9548455). EMBL; AF025531; AAB87665.1; -; mRNA EMBL; EU915609; ACK56075.1; -; mRNA EMBL; EU915610; ACK56076.1; -; mRNA EMBL; BC017412; AAH17412.1; -; mRNA EMBL; BC027916; AAH27916.1; -; mRNA CCDS; CCDS12900.1; -. [Q8N149-2] CCDS; CCDS46179.1; -. [Q8N149-1] RefSeq; NP_006857.2; NM_006866.3 UniGene; Hs.655593; - UniGene; Hs.739156; - PDB; 2OTP; X-ray; 2.60 A; A/B=24-219 PDBsum; 2OTP; - ProteinModelPortal; Q8N149; - SMR; Q8N149; - STRING; 9606.ENSP00000251377; - iPTMnet; Q8N149; - PhosphoSitePlus; Q8N149; - BioMuta; LILRA2; - DMDM; 37537906; - PaxDb; Q8N149; - PeptideAtlas; Q8N149; - PRIDE; Q8N149; - ProteomicsDB; 71558; - ProteomicsDB; 71559; -. [Q8N149-2] DNASU; 11027; - Ensembl; ENST00000251376; ENSP00000251376; ENSG00000239998 Ensembl; ENST00000251377; ENSP00000251377; ENSG00000239998 Ensembl; ENST00000391738; ENSP00000375618; ENSG00000239998 Ensembl; ENST00000611940; ENSP00000478981; ENSG00000275290. [Q8N149-1] Ensembl; ENST00000613573; ENSP00000479743; ENSG00000275290. [Q8N149-2] Ensembl; ENST00000616629; ENSP00000481338; ENSG00000275290. [Q8N149-1] Ensembl; ENST00000617409; ENSP00000479914; ENSG00000274000. [Q8N149-1] Ensembl; ENST00000620279; ENSP00000480939; ENSG00000274000. [Q8N149-2] Ensembl; ENST00000621721; ENSP00000484762; ENSG00000278634. [Q8N149-2] Ensembl; ENST00000622640; ENSP00000483906; ENSG00000278634. [Q8N149-1] GeneID; 11027; - KEGG; hsa:11027; - UCSC; uc002qgf.5; human. [Q8N149-1] CTD; 11027; - DisGeNET; 11027; - EuPathDB; HostDB:ENSG00000239998.5; - GeneCards; LILRA2; - HGNC; HGNC:6603; LILRA2 MIM; 604812; gene neXtProt; NX_Q8N149; - PharmGKB; PA30377; - eggNOG; ENOG410IKJD; Eukaryota eggNOG; ENOG41116BR; LUCA HOGENOM; HOG000234395; - HOVERGEN; HBG074353; - InParanoid; Q8N149; - KO; K06512; - OrthoDB; EOG091G0D6W; - PhylomeDB; Q8N149; - TreeFam; TF336644; - Reactome; R-HSA-198933; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell ChiTaRS; LILRA2; human EvolutionaryTrace; Q8N149; - GeneWiki; LILRA2; - GenomeRNAi; 11027; - PRO; PR:Q8N149; - Proteomes; UP000005640; Chromosome 19 Bgee; ENSG00000239998; - CleanEx; HS_LILRA2; - ExpressionAtlas; Q8N149; baseline and differential Genevisible; Q8N149; HS GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell GO; GO:0005887; C:integral component of plasma membrane; IDA:UniProtKB GO; GO:0003823; F:antigen binding; TAS:ProtInc GO; GO:0001791; F:IgM binding; IDA:UniProtKB GO; GO:0038023; F:signaling receptor activity; TAS:ProtInc GO; GO:0006952; P:defense response; TAS:ProtInc GO; GO:0071611; P:granulocyte colony-stimulating factor production; IMP:UniProtKB GO; GO:0032604; P:granulocyte macrophage colony-stimulating factor production; IMP:UniProtKB GO; GO:0045087; P:innate immune response; IEA:UniProtKB-KW GO; GO:0002220; P:innate immune response activating cell surface receptor signaling pathway; IDA:UniProtKB GO; GO:0032635; P:interleukin-6 production; IMP:UniProtKB GO; GO:0032637; P:interleukin-8 production; IMP:UniProtKB GO; GO:0031665; P:negative regulation of lipopolysaccharide-mediated signaling pathway; IMP:UniProtKB GO; GO:0034144; P:negative regulation of toll-like receptor 4 signaling pathway; IMP:UniProtKB GO; GO:0002283; P:neutrophil activation involved in immune response; IDA:UniProtKB GO; GO:0007165; P:signal transduction; TAS:ProtInc Gene3D; 2.60.40.10; -; 4 InterPro; IPR016332; A1B_glyco/leuk_Ig-like_rcpt InterPro; IPR007110; Ig-like_dom InterPro; IPR036179; Ig-like_dom_sf InterPro; IPR013783; Ig-like_fold InterPro; IPR003599; Ig_sub InterPro; IPR003598; Ig_sub2 InterPro; IPR013151; Immunoglobulin Pfam; PF00047; ig; 1 Pfam; PF13895; Ig_2; 1 PIRSF; PIRSF001979; Alpha_1B_glycoprot_prd; 1 SMART; SM00409; IG; 4 SMART; SM00408; IGc2; 3 SUPFAM; SSF48726; SSF48726; 4 PROSITE; PS50835; IG_LIKE; 2 1: Evidence at protein level; 3D-structure; Alternative splicing; Cell membrane; Complete proteome; Disulfide bond; Glycoprotein; Immunity; Immunoglobulin domain; Innate immunity; Membrane; Nitration; Polymorphism; Receptor; Reference proteome; Repeat; Secreted; Signal; Transmembrane; Transmembrane helix SIGNAL 1 23 CHAIN 24 483 Leukocyte immunoglobulin-like receptor subfamily A member 2 /FTId=PRO_0000014817 TOPO_DOM 24 449 Extracellular. TRANSMEM 450 470 Helical. TOPO_DOM 471 483 Cytoplasmic. DOMAIN 27 113 Ig-like C2-type 1 DOMAIN 117 222 Ig-like C2-type 2 DOMAIN 224 313 Ig-like C2-type 3 DOMAIN 324 413 Ig-like C2-type 4 MOD_RES 404 404 Nitrated tyrosine {ECO:0000250|UniProtKB:P59901} CARBOHYD 64 64 N-linked (GlcNAc...) asparagine CARBOHYD 103 103 N-linked (GlcNAc...) asparagine CARBOHYD 138 138 N-linked (GlcNAc...) asparagine CARBOHYD 279 279 N-linked (GlcNAc...) asparagine CARBOHYD 300 300 N-linked (GlcNAc...) asparagine CARBOHYD 339 339 N-linked (GlcNAc...) asparagine CARBOHYD 429 429 N-linked (GlcNAc...) asparagine DISULFID 49 97 {ECO:0000255|PROSITE-ProRule:PRU00114, ECO:0000269|PubMed:19230061} DISULFID 143 195 {ECO:0000255|PROSITE-ProRule:PRU00114, ECO:0000269|PubMed:19230061} DISULFID 244 295 {ECO:0000255|PROSITE-ProRule:PRU00114} DISULFID 344 395 {ECO:0000255|PROSITE-ProRule:PRU00114} VAR_SEQ 12 23 Missing (in isoform 3) /FTId=VSP_057085 VAR_SEQ 419 436 EAAETLSPSQNKTDSTTT -> A (in isoform 2) /FTId=VSP_008455 VAR_SEQ 436 483 TSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRS LQDAAGR -> SE (in isoform 3 and isoform 4). /FTId=VSP_057086 VARIANT 25 25 H -> L (in dbSNP:rs1834697) /FTId=VAR_016988 VARIANT 25 25 H -> N (in dbSNP:rs1834698) /FTId=VAR_016989 VARIANT 331 331 V -> G (in dbSNP:rs7249811) /FTId=VAR_056051 VARIANT 361 361 G -> A (in dbSNP:rs7249154) /FTId=VAR_056052 VARIANT 381 381 R -> C (in dbSNP:rs7249054) /FTId=VAR_056053 STRAND 30 35 {ECO:0000244|PDB:2OTP} STRAND 37 42 {ECO:0000244|PDB:2OTP} STRAND 45 50 {ECO:0000244|PDB:2OTP} STRAND 83 86 {ECO:0000244|PDB:2OTP} STRAND 93 95 {ECO:0000244|PDB:2OTP} STRAND 112 117 {ECO:0000244|PDB:2OTP} STRAND 124 129 {ECO:0000244|PDB:2OTP} STRAND 139 144 {ECO:0000244|PDB:2OTP} STRAND 152 156 {ECO:0000244|PDB:2OTP} STRAND 159 161 {ECO:0000244|PDB:2OTP} STRAND 164 170 {ECO:0000244|PDB:2OTP} STRAND 173 175 {ECO:0000244|PDB:2OTP} STRAND 178 182 {ECO:0000244|PDB:2OTP} STRAND 192 195 {ECO:0000244|PDB:2OTP} STRAND 203 205 {ECO:0000244|PDB:2OTP} SEQUENCE 483 AA; 52992 MW; 6B57FFC81F8CCF6C CRC64; MTPILTVLIC LGLSLGPRTH VQAGHLPKPT LWAEPGSVII QGSPVTLRCQ GSLQAEEYHL YRENKSASWV RRIQEPGKNG QFPIPSITWE HAGRYHCQYY SHNHSSEYSD PLELVVTGAY SKPTLSALPS PVVTLGGNVT LQCVSQVAFD GFILCKEGED EHPQRLNSHS HARGWSWAIF SVGPVSPSRR WSYRCYAYDS NSPYVWSLPS DLLELLVPGV SKKPSLSVQP GPMVAPGESL TLQCVSDVGY DRFVLYKEGE RDFLQRPGWQ PQAGLSQANF TLGPVSPSHG GQYRCYSAHN LSSEWSAPSD PLDILITGQF YDRPSLSVQP VPTVAPGKNV TLLCQSRGQF HTFLLTKEGA GHPPLHLRSE HQAQQNQAEF RMGPVTSAHV GTYRCYSSLS SNPYLLSLPS DPLELVVSEA AETLSPSQNK TDSTTTSLGQ HPQDYTVENL IRMGVAGLVL VVLGILLFEA QHSQRSLQDA AGR
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Leukocyte Ig-like receptors (LIRs) are a family ofimmunoreceptors expressed predominantly on monocytes and B cellsand at lower levels on dendritic cells and natural killer (NK)cells. All LIRs in subfamily B have an inhibitory function (see,e.g., LILRB1, MIM 604811). LIRs in subfamily A, with shortcytoplasmic domains lacking an immunoreceptor tyrosine-basedinhibitory motif (ITIM) and with transmembrane regions containing acharged arginine residue, may initiate stimulatory cascades. Onemember of subfamily A (LILRA3; MIM 604818) lacks a transmembraneregion and is presumed to be a soluble receptor.

References

Mosbruger, T.L., et al. J. Infect. Dis. 201(9):1371-1380(2010)Davila, S., et al. Genes Immun. 11(3):232-238(2010)Jones, D.C., et al. Eur. J. Immunol. 39(11):3195-3206(2009)Chen, Y., et al. J. Mol. Biol. 386(3):841-853(2009)Mamegano, K., et al. Genes Immun. 9(3):214-223(2008)

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 80.00
Cat# BP10464c
Size:
Quantity:
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions