Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   LILRA5 Antibody (N-term) Blocking peptide   

LILRA5 Antibody (N-term) Blocking peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession A6NI73
Clone Names 100120039
Peptide ID 100120039
Additional Information
Other Names Leukocyte immunoglobulin-like receptor subfamily A member 5, CD85 antigen-like family member F, Immunoglobulin-like transcript 11, ILT-11, Leukocyte immunoglobulin-like receptor 9, LIR-9, CD85f, LILRA5, ILT11, LILRB7, LIR9
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name LILRA5
Synonyms ILT11, LILRB7, LIR9
Function May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.
Cellular Location Cell membrane; Single-pass type I membrane protein
Tissue Location Expressed mostly in tissues of the hematopoietic system, including bone marrow, spleen, lymph node and peripheral leukocytes. Among leukocytes, monocytes and neutrophils express the highest level. Expressed in CD14+ monocytes, but not in T-cells, B-cells or natural killer (NK) cells (at protein level). EMBL; AF212842; AAF73849.1; -; mRNA EMBL; AF324830; AAK52451.1; -; mRNA EMBL; AF499916; AAN27925.1; -; mRNA EMBL; AF499917; AAN27926.1; -; mRNA EMBL; AF499918; AAN27927.1; -; mRNA EMBL; AF499919; AAN27928.1; -; mRNA EMBL; AC008984; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471135; EAW72226.1; -; Genomic_DNA EMBL; CH471135; EAW72227.1; -; Genomic_DNA CCDS; CCDS12888.1; -. [A6NI73-1] CCDS; CCDS12889.1; -. [A6NI73-2] RefSeq; NP_067073.1; NM_021250.3. [A6NI73-1] RefSeq; NP_870994.1; NM_181879.2. [A6NI73-3] RefSeq; NP_871714.1; NM_181985.3. [A6NI73-2] RefSeq; NP_871715.1; NM_181986.2. [A6NI73-4] UniGene; Hs.710986; - PDB; 2D3V; X-ray; 1.85 A; A=42-237 PDBsum; 2D3V; - ProteinModelPortal; A6NI73; - SMR; A6NI73; - STRING; 9606.ENSP00000301219; - iPTMnet; A6NI73; - PhosphoSitePlus; A6NI73; - BioMuta; LILRA5; - PaxDb; A6NI73; - PRIDE; A6NI73; - ProteomicsDB; 1250; - ProteomicsDB; 1251; -. [A6NI73-2] ProteomicsDB; 1252; -. [A6NI73-3] ProteomicsDB; 1253; -. [A6NI73-4] DNASU; 353514; - Ensembl; ENST00000432233; ENSP00000404236; ENSG00000187116. [A6NI73-1] Ensembl; ENST00000486742; ENSP00000484372; ENSG00000187116. [A6NI73-2] Ensembl; ENST00000611164; ENSP00000482658; ENSG00000278355. [A6NI73-2] Ensembl; ENST00000612266; ENSP00000480436; ENSG00000274914. [A6NI73-4] Ensembl; ENST00000612621; ENSP00000484785; ENSG00000278355. [A6NI73-1] Ensembl; ENST00000613559; ENSP00000484775; ENSG00000274914. [A6NI73-3] Ensembl; ENST00000614299; ENSP00000483992; ENSG00000274914. [A6NI73-2] Ensembl; ENST00000615820; ENSP00000480204; ENSG00000274113. [A6NI73-2] Ensembl; ENST00000616133; ENSP00000484062; ENSG00000275404. [A6NI73-4] Ensembl; ENST00000618711; ENSP00000478354; ENSG00000274914. [A6NI73-1] Ensembl; ENST00000619516; ENSP00000480382; ENSG00000278355. [A6NI73-4] Ensembl; ENST00000620091; ENSP00000480458; ENSG00000274113. [A6NI73-1] Ensembl; ENST00000620692; ENSP00000483958; ENSG00000275404. [A6NI73-3] Ensembl; ENST00000620898; ENSP00000484869; ENSG00000275404. [A6NI73-2] Ensembl; ENST00000621042; ENSP00000482882; ENSG00000275404. [A6NI73-1] Ensembl; ENST00000621482; ENSP00000477785; ENSG00000278355. [A6NI73-3] GeneID; 353514; - KEGG; hsa:353514; - UCSC; uc032idp.1; human. [A6NI73-1] CTD; 353514; - DisGeNET; 353514; - EuPathDB; HostDB:ENSG00000187116.13; - GeneCards; LILRA5; - HGNC; HGNC:16309; LILRA5 MIM; 606047; gene neXtProt; NX_A6NI73; - OpenTargets; ENSG00000187116; - PharmGKB; PA142671547; - eggNOG; ENOG410JB9F; Eukaryota eggNOG; ENOG41114EZ; LUCA GeneTree; ENSGT00760000119033; - HOGENOM; HOG000234395; - HOVERGEN; HBG074353; - InParanoid; A6NI73; - KO; K06512; - OMA; ILIFQDW; - OrthoDB; EOG091G0D6W; - PhylomeDB; A6NI73; - TreeFam; TF336644; - Reactome; R-HSA-198933; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell EvolutionaryTrace; A6NI73; - GenomeRNAi; 353514; - PRO; PR:A6NI73; - Proteomes; UP000005640; Chromosome 19 Bgee; ENSG00000187116; - CleanEx; HS_LILRA5; - Genevisible; A6NI73; HS GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell GO; GO:0045087; P:innate immune response; IEA:UniProtKB-KW Gene3D; 2.60.40.10; -; 2 InterPro; IPR007110; Ig-like_dom InterPro; IPR036179; Ig-like_dom_sf InterPro; IPR013783; Ig-like_fold InterPro; IPR003599; Ig_sub InterPro; IPR003598; Ig_sub2 Pfam; PF13895; Ig_2; 1 SMART; SM00409; IG; 2 SMART; SM00408; IGc2; 1 SUPFAM; SSF48726; SSF48726; 2 1: Evidence at protein level; 3D-structure; Alternative splicing; Cell membrane; Complete proteome; Disulfide bond; Glycoprotein; Immunity; Immunoglobulin domain; Innate immunity; Membrane; Receptor; Reference proteome; Repeat; Secreted; Signal; Transmembrane; Transmembrane helix SIGNAL 1 41 CHAIN 42 299 Leukocyte immunoglobulin-like receptor subfamily A member 5 /FTId=PRO_0000318708 TOPO_DOM 42 268 Extracellular. TRANSMEM 269 289 Helical. TOPO_DOM 290 299 Cytoplasmic. DOMAIN 51 136 Ig-like C2-type 1 DOMAIN 142 230 Ig-like C2-type 2 CARBOHYD 43 43 N-linked (GlcNAc...) asparagine CARBOHYD 157 157 N-linked (GlcNAc...) asparagine CARBOHYD 248 248 N-linked (GlcNAc...) asparagine DISULFID 67 116 {ECO:0000244|PDB:2D3V, ECO:0000269|PubMed:16675463} DISULFID 162 214 {ECO:0000244|PDB:2D3V, ECO:0000269|PubMed:16675463} VAR_SEQ 31 42 Missing (in isoform 2 and isoform 4) /FTId=VSP_031276 VAR_SEQ 239 299 AADNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVL GILIFQDWHSQRSPQAAAGR -> EEATVFSSTIQGSQTGC GELYRQGSPC (in isoform 3 and isoform 4) /FTId=VSP_031277 CONFLICT 100 100 R -> G (in Ref. 1; AAF73849) CONFLICT 220 220 H -> R (in Ref. 1; AAF73849) STRAND 48 53 {ECO:0000244|PDB:2D3V} STRAND 55 58 {ECO:0000244|PDB:2D3V} STRAND 63 68 {ECO:0000244|PDB:2D3V} STRAND 75 80 {ECO:0000244|PDB:2D3V} STRAND 87 90 {ECO:0000244|PDB:2D3V} STRAND 98 105 {ECO:0000244|PDB:2D3V} HELIX 108 110 {ECO:0000244|PDB:2D3V} STRAND 112 120 {ECO:0000244|PDB:2D3V} STRAND 131 136 {ECO:0000244|PDB:2D3V} STRAND 143 145 {ECO:0000244|PDB:2D3V} STRAND 159 166 {ECO:0000244|PDB:2D3V} STRAND 169 175 {ECO:0000244|PDB:2D3V} STRAND 182 186 {ECO:0000244|PDB:2D3V} STRAND 195 200 {ECO:0000244|PDB:2D3V} STRAND 210 218 {ECO:0000244|PDB:2D3V} STRAND 221 225 {ECO:0000244|PDB:2D3V} STRAND 232 234 {ECO:0000244|PDB:2D3V} SEQUENCE 299 AA; 32755 MW; F5EE25361D4E0F02 CRC64; MAPWSHPSAQ LQPVGGDAVS PALMVLLCLG LSLGPRTHVQ AGNLSKATLW AEPGSVISRG NSVTIRCQGT LEAQEYRLVK EGSPEPWDTQ NPLEPKNKAR FSIPSMTEHH AGRYRCYYYS PAGWSEPSDP LELVVTGFYN KPTLSALPSP VVTSGENVTL QCGSRLRFDR FILTEEGDHK LSWTLDSQLT PSGQFQALFP VGPVTPSHRW MLRCYGSRRH ILQVWSEPSD LLEIPVSGAA DNLSPSQNKS DSGTASHLQD YAVENLIRMG MAGLILVVLG ILIFQDWHSQ RSPQAAAGR
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

The protein encoded by this gene is a member of theleukocyte immunoglobulin-like receptor (LIR) family. LIR familymembers are known to have activating and inibitory functions inleukocytes. Crosslink of this receptor protein on the surface ofmonocytes has been shown to induce calcium flux and secretion ofseveral proinflammatory cytokines, which suggests the roles of thisprotein in triggering innate immune responses. This gene is one ofthe leukocyte receptor genes that form a gene cluster on thechromosomal region 19q13.4. Four alternatively spliced transcriptvariants encoding distinct isoforms have been described. [providedby RefSeq].

References

Mosbruger, T.L., et al. J. Infect. Dis. 201(9):1371-1380(2010)Jones, D.C., et al. Eur. J. Immunol. 39(11):3195-3206(2009)Shiroishi, M., et al. J. Biol. Chem. 281(28):19536-19544(2006)Borges, L., et al. Blood 101(4):1484-1486(2003)Wende, H., et al. Immunogenetics 51 (8-9), 703-713 (2000) :

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 80.00
Cat# BP11643a
Size:
Quantity:
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions