Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   HMMR Antibody (C-term) Blocking peptide   

HMMR Antibody (C-term) Blocking peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession O75330
Clone Names 80317188
Peptide ID 80317188
Additional Information
Other Names Hyaluronan mediated motility receptor, Intracellular hyaluronic acid-binding protein, Receptor for hyaluronan-mediated motility, CD168, HMMR, IHABP, RHAMM
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name HMMR
Synonyms IHABP, RHAMM
Function Involved in cell motility. When hyaluronan binds to HMMR, the phosphorylation of a number of proteins, including PTK2/FAK1 occurs. May also be involved in cellular transformation and metastasis formation, and in regulating extracellular- regulated kinase (ERK) activity.
Cellular Location Cell surface. Cytoplasm.
Tissue Location Expressed in breast cancer cell lines and in normal breast tissue EMBL; U29343; AAC52049.1; -; mRNA EMBL; AF032862; AAC32548.1; -; mRNA EMBL; AK290577; BAF83266.1; -; mRNA EMBL; AK303616; BAG64626.1; -; mRNA EMBL; AC112205; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471062; EAW61522.1; -; Genomic_DNA EMBL; CH471062; EAW61523.1; -; Genomic_DNA EMBL; CH471062; EAW61524.1; -; Genomic_DNA EMBL; CH471062; EAW61525.1; -; Genomic_DNA EMBL; BC108904; AAI08905.1; -; mRNA CCDS; CCDS4362.1; -. [O75330-1] CCDS; CCDS4363.1; -. [O75330-2] CCDS; CCDS47334.1; -. [O75330-3] CCDS; CCDS47335.1; -. [O75330-4] PIR; JC5016; JC5016 RefSeq; NP_001136028.1; NM_001142556.1. [O75330-3] RefSeq; NP_001136029.1; NM_001142557.1. [O75330-4] RefSeq; NP_036616.2; NM_012484.2. [O75330-1] RefSeq; NP_036617.2; NM_012485.2. [O75330-2] UniGene; Hs.740467; - ProteinModelPortal; O75330; - SMR; O75330; - BioGrid; 109404; 47 DIP; DIP-56496N; - IntAct; O75330; 27 MINT; MINT-4989385; - STRING; 9606.ENSP00000377492; - DrugBank; DB08818; Hyaluronic acid iPTMnet; O75330; - PhosphoSitePlus; O75330; - BioMuta; HMMR; - REPRODUCTION-2DPAGE; O75330; - EPD; O75330; - MaxQB; O75330; - PaxDb; O75330; - PeptideAtlas; O75330; - PRIDE; O75330; - Ensembl; ENST00000353866; ENSP00000185942; ENSG00000072571. [O75330-2] Ensembl; ENST00000358715; ENSP00000351554; ENSG00000072571. [O75330-1] Ensembl; ENST00000393915; ENSP00000377492; ENSG00000072571. [O75330-3] Ensembl; ENST00000432118; ENSP00000402673; ENSG00000072571. [O75330-4] GeneID; 3161; - KEGG; hsa:3161; - UCSC; uc003lzf.5; human. [O75330-1] CTD; 3161; - DisGeNET; 3161; - GeneCards; HMMR; - H-InvDB; HIX0032412; - HGNC; HGNC:5012; HMMR HPA; CAB002433; - HPA; HPA040025; - HPA; HPA043926; - MalaCards; HMMR; - MIM; 600936; gene neXtProt; NX_O75330; - OpenTargets; ENSG00000072571; - PharmGKB; PA29340; - eggNOG; ENOG410IJ28; Eukaryota eggNOG; ENOG4111G1K; LUCA GeneTree; ENSGT00390000007135; - HOVERGEN; HBG044411; - InParanoid; O75330; - KO; K06267; - OMA; NCSALME; - OrthoDB; EOG091G03MO; - PhylomeDB; O75330; - TreeFam; TF333963; - BioCyc; ZFISH:ENSG00000072571-MONOMER; - Reactome; R-HSA-2160916; Hyaluronan uptake and degradation Reactome; R-HSA-8854518; AURKA Activation by TPX2 GeneWiki; Hyaluronan-mediated_motility_receptor; - GenomeRNAi; 3161; - PRO; PR:O75330; - Proteomes; UP000005640; Chromosome 5 Bgee; ENSG00000072571; - CleanEx; HS_HMMR; - ExpressionAtlas; O75330; baseline and differential Genevisible; O75330; HS GO; GO:0009986; C:cell surface; IEA:UniProtKB-SubCell GO; GO:0005829; C:cytosol; TAS:Reactome GO; GO:0016020; C:membrane; IDA:UniProtKB GO; GO:0005886; C:plasma membrane; TAS:Reactome GO; GO:0005540; F:hyaluronic acid binding; IBA:GO_Central GO; GO:0000086; P:G2/M transition of mitotic cell cycle; TAS:Reactome GO; GO:0030214; P:hyaluronan catabolic process; TAS:Reactome InterPro; IPR031794; HMMR_C InterPro; IPR031787; HMMR_N InterPro; IPR026203; IHABP PANTHER; PTHR18956; PTHR18956; 1 Pfam; PF15908; HMMR_C; 1 Pfam; PF15905; HMMR_N; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Cytoplasm; Glycoprotein; Hyaluronic acid; Phosphoprotein; Polymorphism; Reference proteome; Repeat CHAIN 1 724 Hyaluronan mediated motility receptor /FTId=PRO_0000084007 REGION 635 645 Hyaluronic acid-binding. REGION 657 666 Hyaluronic acid-binding. MOD_RES 20 20 Phosphoserine MOD_RES 703 703 Phosphothreonine CARBOHYD 133 133 N-linked (GlcNAc...). CARBOHYD 477 477 N-linked (GlcNAc...). CARBOHYD 567 567 N-linked (GlcNAc...). CARBOHYD 588 588 N-linked (GlcNAc...). VAR_SEQ 1 90 MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKS QRFKQQKESKQNLNVDKDTTLPASARKVKSSESKESQKNDK DLKILEKE -> MTLL (in isoform 4) /FTId=VSP_041266 VAR_SEQ 75 75 K -> KK (in isoform 3) /FTId=VSP_038378 VAR_SEQ 76 90 Missing (in isoform 2) /FTId=VSP_004286 VARIANT 92 92 R -> C (in dbSNP:rs299284) /FTId=VAR_024155 VARIANT 305 305 N -> K (in dbSNP:rs2303077) /FTId=VAR_031661 VARIANT 320 320 N -> K (in dbSNP:rs2303077) /FTId=VAR_056917 VARIANT 332 332 R -> H (in dbSNP:rs2303078) /FTId=VAR_024156 VARIANT 368 368 V -> A (in dbSNP:rs299290) /FTId=VAR_020044 VARIANT 484 484 A -> V (in dbSNP:rs299295) /FTId=VAR_024157 VARIANT 557 557 D -> H (in dbSNP:rs2230362) /FTId=VAR_056918 VARIANT 595 595 L -> I (in dbSNP:rs2230363) /FTId=VAR_056919 CONFLICT 103 103 R -> S (in Ref. 2; AAC32548) CONFLICT 277 277 E -> D (in Ref. 1; AAC52049) CONFLICT 298 298 K -> T (in Ref. 1; AAC52049) CONFLICT 322 322 K -> E (in Ref. 1; AAC52049) CONFLICT 330 332 QER -> REH (in Ref. 1; AAC52049) CONFLICT 547 547 Q -> R (in Ref. 3; BAF83266) SEQUENCE 724 AA; 84100 MW; F2C3C0DBA863955F CRC64; MSFPKAPLKR FNDPSGCAPS PGAYDVKTLE VLKGPVSFQK SQRFKQQKES KQNLNVDKDT TLPASARKVK SSESKESQKN DKDLKILEKE IRVLLQERGA QDRRIQDLET ELEKMEARLN AALREKTSLS ANNATLEKQL IELTRTNELL KSKFSENGNQ KNLRILSLEL MKLRNKRETK MRGMMAKQEG MEMKLQVTQR SLEESQGKIA QLEGKLVSIE KEKIDEKSET EKLLEYIEEI SCASDQVEKY KLDIAQLEEN LKEKNDEILS LKQSLEENIV ILSKQVEDLN VKCQLLEKEK EDHVNRNREH NENLNAEMQN LKQKFILEQQ EREKLQQKEL QIDSLLQQEK ELSSSLHQKL CSFQEEMVKE KNLFEEELKQ TLDELDKLQQ KEEQAERLVK QLEEEAKSRA EELKLLEEKL KGKEAELEKS SAAHTQATLL LQEKYDSMVQ SLEDVTAQFE SYKALTASEI EDLKLENSSL QEKAAKAGKN AEDVQHQILA TESSNQEYVR MLLDLQTKSA LKETEIKEIT VSFLQKITDL QNQLKQQEED FRKQLEDEEG RKAEKENTTA ELTEEINKWR LLYEELYNKT KPFQLQLDAF EVEKQALLNE HGAAQEQLNK IRDSYAKLLG HQNLKQKIKH VVKLKDENSQ LKSEVSKLRC QLAKKKQSET KLQEELNKVL GIKHFDPSKA FHHESKENFA LKTPLKEGNT NCYRAPMECQ ESWK
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

PLEKHA4 binds specifically to phosphatidylinositol-3-phosphate (PtdIns3P), but not to other phosphoinositides.

References

Stelzl, U., et al. Cell 122(6):957-968(2005)Dowler, S., et al. Biochem. J. 351 (PT 1), 19-31 (2000) :

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 80.00
Cat# BP11771b
Size:
Quantity:
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Buy Antibody, Get One  Selected Loading Control Free.
30% off on 400+ Stem Cells Antibodies. PromoCode: <span class=text-red>FLASH19</span>
Terms & Conditions