Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   APRG1 Antibody (Center) Blocking Peptide   

APRG1 Antibody (Center) Blocking Peptide

Synthetic peptide

Product Information
Primary Accession Q8IVJ8
Other Accession NP_848032.1, NP_848029.2
Clone Names 91208051
Peptide ID 91208051
Additional Information
Other Names AP20 region protein 1, APRG1, C3orf35
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name APRG1
Synonyms C3orf35
Cellular Location Membrane; Single-pass membrane protein
Tissue Location Isoform 1 is expressed at high levels in the pancreas and placenta. Isoform 2 is expressed at high levels in the kidney. EMBL; AJ493599; CAD42702.1; -; mRNA EMBL; AJ493600; CAD42703.1; -; mRNA EMBL; AJ493603; CAD42706.1; -; mRNA EMBL; AC092055; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC136290; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC132691; AAI32692.1; -; mRNA EMBL; BC133024; AAI33025.1; -; mRNA EMBL; BC144376; AAI44377.1; -; mRNA EMBL; BC144377; AAI44378.1; -; mRNA RefSeq; NP_001289760.1; NM_001302831.1. [Q8IVJ8-3] RefSeq; NP_001289761.1; NM_001302832.1. [Q8IVJ8-3] RefSeq; NP_848029.2; NM_178339.2. [Q8IVJ8-1] RefSeq; NP_848032.1; NM_178342.2. [Q8IVJ8-3] RefSeq; NP_848034.2; NM_178344.2. [Q8IVJ8-3] RefSeq; XP_016861780.1; XM_017006291.1. [Q8IVJ8-3] RefSeq; XP_016861781.1; XM_017006292.1. [Q8IVJ8-3] RefSeq; XP_016861782.1; XM_017006293.1. [Q8IVJ8-3] RefSeq; XP_016861783.1; XM_017006294.1. [Q8IVJ8-3] RefSeq; XP_016861784.1; XM_017006295.1. [Q8IVJ8-3] RefSeq; XP_016861785.1; XM_017006296.1. [Q8IVJ8-3] UniGene; Hs.475945; - ProteinModelPortal; Q8IVJ8; - SMR; Q8IVJ8; - STRING; 9606.ENSP00000331625; - BioMuta; APRG1; - PaxDb; Q8IVJ8; - PRIDE; Q8IVJ8; - DNASU; 339883; - GeneID; 339883; - KEGG; hsa:339883; - CTD; 339883; - DisGeNET; 339883; - GeneCards; C3orf35; - HGNC; HGNC:24082; C3orf35 HPA; HPA047196; - MIM; 611429; gene neXtProt; NX_Q8IVJ8; - PharmGKB; PA142672396; - eggNOG; ENOG410KGBD; Eukaryota eggNOG; ENOG4110SFU; LUCA HOGENOM; HOG000034016; - InParanoid; Q8IVJ8; - PhylomeDB; Q8IVJ8; - BioCyc; ZFISH:G66-31410-MONOMER; - GenomeRNAi; 339883; - PRO; PR:Q8IVJ8; - Proteomes; UP000005640; Unplaced Bgee; ENSG00000198590; - CleanEx; HS_C3orf35; - GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW 2: Evidence at transcript level; Alternative splicing; Complete proteome; Membrane; Polymorphism; Reference proteome; Transmembrane; Transmembrane helix CHAIN 1 170 AP20 region protein 1 /FTId=PRO_0000288935 TRANSMEM 150 170 Helical. VAR_SEQ 77 170 KKTEVQKREGTDSIPAAGRSGTANQPSIAPHRCLFSRGITA LDGLKRGRGCNGAAHLVRGDAWKTKLGEPWVSIALALAGPG AILILELSWFLG -> DCMLVSLAKNKVNVFGAIINMAASV SGVIGGLKFSRTYYVKGI (in isoform 3) /FTId=VSP_025846 VAR_SEQ 79 170 Missing (in isoform 2) /FTId=VSP_025845 VARIANT 107 107 H -> Y (in dbSNP:rs17266511) /FTId=VAR_032538 CONFLICT 104 104 I -> V (in Ref. 1; CAD42703) CONFLICT 131 131 A -> S (in Ref. 1; CAD42703) SEQUENCE 170 AA; 18525 MW; BA90128339FE92D3 CRC64; MKTMATRKRC KLSRTGPEFE NVIKRLLCAR TFHTRIGGDL THGIINRGRR ANAEQMGLQG SAQHFNIFPL DLWTQGKKTE VQKREGTDSI PAAGRSGTAN QPSIAPHRCL FSRGITALDG LKRGRGCNGA AHLVRGDAWK TKLGEPWVSI ALALAGPGAI LILELSWFLG
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


Leris, A.C., et al. Breast Cancer Res. Treat. 93(2):97-100(2005)Senchenko, V.N., et al. Oncogene 23(34):5719-5728(2004)Senchenko, V., et al. Oncogene 22(19):2984-2992(2003)Protopopov, A., et al. Cancer Res. 63(2):404-412(2003)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 80.00
Cat# BP16153c
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions