Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   FOXJ2 Antibody (N-term) Blocking Peptide   

FOXJ2 Antibody (N-term) Blocking Peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession Q9P0K8
Clone Names 100603110
Peptide ID 100603110
Additional Information
Other Names Forkhead box protein J2, Fork head homologous X, FOXJ2, FHX
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name FOXJ2
Synonyms FHX
Function Transcriptional activator. Able to bind to two different type of DNA binding sites. Isoform FOXJ2.L behaves as a more potent transactivator than FOXJ2.S.
Cellular Location Nucleus.
Tissue Location Widely expressed. EMBL; AF155132; AAF65927.1; -; mRNA EMBL; AF155133; AAK49016.1; -; mRNA EMBL; BC126396; AAI26397.1; -; mRNA EMBL; BC136305; AAI36306.1; -; mRNA EMBL; AL161978; CAB82315.1; -; mRNA CCDS; CCDS8587.1; -. [Q9P0K8-1] PIR; T47161; T47161 RefSeq; NP_060886.1; NM_018416.2. [Q9P0K8-1] UniGene; Hs.120844; - ProteinModelPortal; Q9P0K8; - SMR; Q9P0K8; - BioGrid; 120920; 76 IntAct; Q9P0K8; 74 MINT; Q9P0K8; - iPTMnet; Q9P0K8; - PhosphoSitePlus; Q9P0K8; - BioMuta; FOXJ2; - DMDM; 13626933; - EPD; Q9P0K8; - MaxQB; Q9P0K8; - PaxDb; Q9P0K8; - PeptideAtlas; Q9P0K8; - PRIDE; Q9P0K8; - ProteomicsDB; 83564; - ProteomicsDB; 83565; -. [Q9P0K8-2] DNASU; 55810; - Ensembl; ENST00000162391; ENSP00000162391; ENSG00000065970. [Q9P0K8-1] Ensembl; ENST00000428177; ENSP00000403411; ENSG00000065970. [Q9P0K8-2] GeneID; 55810; - KEGG; hsa:55810; - UCSC; uc001qtt.2; human. [Q9P0K8-1] CTD; 55810; - DisGeNET; 55810; - EuPathDB; HostDB:ENSG00000065970.8; - GeneCards; FOXJ2; - HGNC; HGNC:24818; FOXJ2 HPA; HPA008723; - neXtProt; NX_Q9P0K8; - OpenTargets; ENSG00000065970; - PharmGKB; PA134982817; - eggNOG; KOG2294; Eukaryota eggNOG; COG5025; LUCA GeneTree; ENSGT00920000148974; - HOGENOM; HOG000231184; - HOVERGEN; HBG051648; - InParanoid; Q9P0K8; - KO; K09403; - OMA; TNHDFKF; - OrthoDB; EOG091G0U7S; - PhylomeDB; Q9P0K8; - TreeFam; TF333250; - SignaLink; Q9P0K8; - ChiTaRS; FOXJ2; human GeneWiki; FOXJ2; - GenomeRNAi; 55810; - PRO; PR:Q9P0K8; - Proteomes; UP000005640; Chromosome 12 Bgee; ENSG00000065970; - CleanEx; HS_FOXJ2; - Genevisible; Q9P0K8; HS GO; GO:0001650; C:fibrillar center; IDA:HPA GO; GO:0005634; C:nucleus; IDA:BHF-UCL GO; GO:0042802; F:identical protein binding; IPI:IntAct GO; GO:0000978; F:RNA polymerase II proximal promoter sequence-specific DNA binding; IDA:NTNU_SB GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; ISA:NTNU_SB GO; GO:0043565; F:sequence-specific DNA binding; IDA:UniProtKB GO; GO:0001077; F:transcriptional activator activity, RNA polymerase II proximal promoter sequence-specific DNA binding; IDA:NTNU_SB GO; GO:0009653; P:anatomical structure morphogenesis; IBA:GO_Central GO; GO:0030154; P:cell differentiation; IBA:GO_Central GO; GO:0016525; P:negative regulation of angiogenesis; IMP:BHF-UCL GO; GO:0110059; P:negative regulation of blood vessel endothelial cell differentiation; IDA:BHF-UCL GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IDA:NTNU_SB GO; GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:UniProtKB GO; GO:1904707; P:positive regulation of vascular smooth muscle cell proliferation; IDA:BHF-UCL CDD; cd00059; FH; 1 Gene3D; 1.10.10.10; -; 1 InterPro; IPR001766; Fork_head_dom InterPro; IPR030456; TF_fork_head_CS_2 InterPro; IPR036388; WH-like_DNA-bd_sf InterPro; IPR036390; WH_DNA-bd_sf Pfam; PF00250; Forkhead; 1 PRINTS; PR00053; FORKHEAD SMART; SM00339; FH; 1 SUPFAM; SSF46785; SSF46785; 1 PROSITE; PS00658; FORK_HEAD_2; 1 PROSITE; PS50039; FORK_HEAD_3; 1 1: Evidence at protein level; Acetylation; Activator; Alternative splicing; Complete proteome; DNA-binding; Nucleus; Phosphoprotein; Polymorphism; Reference proteome; Transcription; Transcription regulation INIT_MET 1 1 Removed. CHAIN 2 574 Forkhead box protein J2 /FTId=PRO_0000091853 DNA_BIND 66 143 Fork-head. {ECO:0000255|PROSITE- ProRule:PRU00089} COMPBIAS 266 270 Poly-Ser COMPBIAS 291 294 Poly-Gln COMPBIAS 295 298 Poly-Pro COMPBIAS 299 306 Poly-Gln COMPBIAS 313 321 Poly-Gln COMPBIAS 390 395 Poly-Pro MOD_RES 2 2 N-acetylalanine MOD_RES 3 3 Phosphoserine MOD_RES 46 46 Phosphoserine MOD_RES 161 161 Phosphoserine MOD_RES 164 164 Phosphoserine MOD_RES 172 172 Phosphoserine VAR_SEQ 513 574 VNSYGHPQAPHLYPGPSPMYPIPTQDSAGYNRPAHHMVPRP SVPPPGANEEIPDDFDWDLIT -> GTAPSQLPWRWRLC (in isoform FOXJ2.S) /FTId=VSP_001544 VARIANT 229 229 P -> R (in dbSNP:rs35642012) /FTId=VAR_049162 VARIANT 310 310 P -> S (in dbSNP:rs2277415) /FTId=VAR_021842 SEQUENCE 574 AA; 62395 MW; 258120EDAE4B11EB CRC64; MASDLESSLT SIDWLPQLTL RATIEKLGSA SQAGPPGSSR KCSPGSPTDP NATLSKDEAA VHQDGKPRYS YATLITYAIN SSPAKKMTLS EIYRWICDNF PYYKNAGIGW KNSIRHNLSL NKCFRKVPRP RDDPGKGSYW TIDTCPDISR KRRHPPDDDL SQDSPEQEAS KSPRGGVAGS GEASLPPEGN PQMSLQSPTS IASYSQGTGS VDGGAVAAGA SGRESAEGPP PLYNTNHDFK FSYSEINFQD LSWSFRNLYK SMLEKSSSSS QHGFSSLLGD IPPSNNYYMY QQQQPPPPQQ QQQQQQPPQP PPQQSQPQQQ QAPAQGPSAV GGAPPLHTPS TDGCTPPGGK QAGAEGYGPP PVMAMHPPPL QHGGYHPHQH HPHSHPAQQP PPPQPQAQGQ APINNTGFAF PSDWCSNIDS LKESFKMVNR LNWSSIEQSQ FSELMESLRQ AEQKNWTLDQ HHIANLCDSL NHFLTQTGHV PPQGGTHRPP APARIADSCA LTSGKQESAM SQVNSYGHPQ APHLYPGPSP MYPIPTQDSA GYNRPAHHMV PRPSVPPPGA NEEIPDDFDW DLIT
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

FOXJ2 is a transcriptional activator. Able to bind to two different type of DNA binding sites. Isoform FOXJ2.L behaves as a more potent transactivator than FOXJ2.S.

References

Han, S., et al. Hum. Immunol. 71(7):727-730(2010)Rajaraman, P., et al. Cancer Epidemiol. Biomarkers Prev. 19(5):1356-1361(2010)Davila, S., et al. Genes Immun. 11(3):232-238(2010)Rajaraman, P., et al. Cancer Epidemiol. Biomarkers Prev. 18(5):1651-1658(2009)Ferrell, R.E., et al. Lymphat Res Biol 6(2):69-76(2008)

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 80.00
Cat# BP16715a
Size:
Quantity:
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions