Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   MYRIP Antibody (C-term) Blocking Peptide   

MYRIP Antibody (C-term) Blocking Peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession Q8NFW9
Clone Names 110617151
Peptide ID 110617151
Additional Information
Other Names Rab effector MyRIP, Exophilin-8, Myosin-VIIa- and Rab-interacting protein, Synaptotagmin-like protein lacking C2 domains C, SlaC2-c, Slp homolog lacking C2 domains c, MYRIP, SLAC2C
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name MYRIP
Synonyms SLAC2C
Function Rab effector protein involved in melanosome transport. Serves as link between melanosome-bound RAB27A and the motor proteins MYO5A and MYO7A. May link RAB27A-containing vesicles to actin filaments. Functions as a protein kinase A-anchoring protein (AKAP). May act as a scaffolding protein that links PKA to components of the exocytosis machinery, thus facilitating exocytosis, including insulin release (By similarity).
Cellular Location Cytoplasm {ECO:0000250|UniProtKB:Q8K3I4}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q7TNY7} Cytoplasmic vesicle, secretory vesicle {ECO:0000250|UniProtKB:Q7TNY7}. Note=In presynaptic and postsynaptic areas in photoreceptor cells and in the basal microvilli of retinal pigment epithelium cells. Associated with melanosomes. Colocalizes with actin filaments {ECO:0000250|UniProtKB:Q7TNY7}
Tissue Location Detected in brain, skin, heart, adrenal medulla, pancreas, intestine, liver, kidney, muscle and testis EMBL; AF396687; AAM43954.1; -; mRNA EMBL; AB083783; BAC15555.1; -; mRNA EMBL; AK125334; BAG54185.1; -; mRNA EMBL; AK126013; BAG54276.1; -; mRNA EMBL; AK294714; BAH11857.1; -; mRNA EMBL; AK316068; BAH14439.1; -; mRNA EMBL; AC099331; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC099557; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC104188; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC110718; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AC130439; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471055; EAW64595.1; -; Genomic_DNA EMBL; BC092512; AAH92512.1; -; mRNA EMBL; BC109311; AAI09312.1; -; mRNA EMBL; BC109312; AAI09313.1; -; mRNA EMBL; AL050090; CAB43262.1; -; mRNA CCDS; CCDS2689.1; -. [Q8NFW9-1] CCDS; CCDS68390.1; -. [Q8NFW9-2] CCDS; CCDS68391.1; -. [Q8NFW9-6] CCDS; CCDS68392.1; -. [Q8NFW9-4] PIR; T08739; T08739 RefSeq; NP_001271352.1; NM_001284423.1. [Q8NFW9-1] RefSeq; NP_001271353.1; NM_001284424.1. [Q8NFW9-2] RefSeq; NP_001271354.1; NM_001284425.1. [Q8NFW9-6] RefSeq; NP_001271355.1; NM_001284426.1. [Q8NFW9-4] RefSeq; NP_056275.2; NM_015460.3. [Q8NFW9-1] RefSeq; XP_011531877.1; XM_011533575.1. [Q8NFW9-1] UniGene; Hs.594535; - ProteinModelPortal; Q8NFW9; - SMR; Q8NFW9; - BioGrid; 117424; 3 DIP; DIP-48949N; - IntAct; Q8NFW9; 9 MINT; Q8NFW9; - STRING; 9606.ENSP00000301972; - iPTMnet; Q8NFW9; - PhosphoSitePlus; Q8NFW9; - BioMuta; MYRIP; - DMDM; 116242669; - PaxDb; Q8NFW9; - PeptideAtlas; Q8NFW9; - PRIDE; Q8NFW9; - ProteomicsDB; 73377; - ProteomicsDB; 73378; -. [Q8NFW9-2] ProteomicsDB; 73379; -. [Q8NFW9-3] ProteomicsDB; 73380; -. [Q8NFW9-4] ProteomicsDB; 73381; -. [Q8NFW9-5] Ensembl; ENST00000302541; ENSP00000301972; ENSG00000170011. [Q8NFW9-1] Ensembl; ENST00000396217; ENSP00000379519; ENSG00000170011. [Q8NFW9-6] Ensembl; ENST00000425621; ENSP00000389323; ENSG00000170011. [Q8NFW9-2] Ensembl; ENST00000444716; ENSP00000398665; ENSG00000170011. [Q8NFW9-1] Ensembl; ENST00000458292; ENSP00000413392; ENSG00000170011. [Q8NFW9-5] Ensembl; ENST00000539167; ENSP00000438297; ENSG00000170011. [Q8NFW9-4] GeneID; 25924; - KEGG; hsa:25924; - UCSC; uc003cka.5; human. [Q8NFW9-1] CTD; 25924; - DisGeNET; 25924; - EuPathDB; HostDB:ENSG00000170011.13; - GeneCards; MYRIP; - HGNC; HGNC:19156; MYRIP HPA; HPA006433; - MIM; 611790; gene neXtProt; NX_Q8NFW9; - OpenTargets; ENSG00000170011; - PharmGKB; PA38800; - eggNOG; ENOG410IHBX; Eukaryota eggNOG; ENOG41126RD; LUCA GeneTree; ENSGT00390000013933; - HOGENOM; HOG000113712; - HOVERGEN; HBG052562; - InParanoid; Q8NFW9; - KO; K22237; - OMA; HSGTDET; - OrthoDB; EOG091G01RQ; - PhylomeDB; Q8NFW9; - TreeFam; TF331599; - Reactome; R-HSA-264876; Insulin processing ChiTaRS; MYRIP; human GenomeRNAi; 25924; - PRO; PR:Q8NFW9; - Proteomes; UP000005640; Chromosome 3 Bgee; ENSG00000170011; - CleanEx; HS_MYRIP; - ExpressionAtlas; Q8NFW9; baseline and differential Genevisible; Q8NFW9; HS GO; GO:0030864; C:cortical actin cytoskeleton; IBA:GO_Central GO; GO:0031045; C:dense core granule; ISS:UniProtKB GO; GO:0000145; C:exocyst; IEA:Ensembl GO; GO:0042470; C:melanosome; IEA:Ensembl GO; GO:0048471; C:perinuclear region of cytoplasm; ISS:UniProtKB GO; GO:0001750; C:photoreceptor outer segment; IEA:Ensembl GO; GO:0045202; C:synapse; IEA:Ensembl GO; GO:0030133; C:transport vesicle; IEA:UniProtKB-SubCell GO; GO:0003779; F:actin binding; IBA:GO_Central GO; GO:0017022; F:myosin binding; IBA:GO_Central GO; GO:0051018; F:protein kinase A binding; IEA:Ensembl GO; GO:0017137; F:Rab GTPase binding; IBA:GO_Central GO; GO:0008270; F:zinc ion binding; NAS:UniProtKB GO; GO:0006886; P:intracellular protein transport; IEA:InterPro GO; GO:0032024; P:positive regulation of insulin secretion; ISS:UniProtKB GO; GO:0030050; P:vesicle transport along actin filament; IBA:GO_Central Gene3D; 3.30.40.10; -; 1 InterPro; IPR006788; Myrip/Melanophilin InterPro; IPR010911; Rab_BD InterPro; IPR011011; Znf_FYVE_PHD InterPro; IPR013083; Znf_RING/FYVE/PHD Pfam; PF04698; Rab_eff_C; 1 SUPFAM; SSF57903; SSF57903; 1 PROSITE; PS50916; RABBD; 1 1: Evidence at protein level; Actin-binding; Alternative splicing; Complete proteome; Cytoplasm; Cytoplasmic vesicle; Metal-binding; Phosphoprotein; Polymorphism; Reference proteome; Repeat; Zinc; Zinc-finger CHAIN 1 859 Rab effector MyRIP /FTId=PRO_0000190224 DOMAIN 4 124 RabBD. {ECO:0000255|PROSITE- ProRule:PRU00234} ZN_FING 63 105 FYVE-type REGION 143 560 Myosin-binding REGION 193 209 PKA-binding. REGION 232 248 Negative regulation of PKA-binding REGION 495 856 Actin-binding MOD_RES 298 298 Phosphoserine {ECO:0000250|UniProtKB:Q8K3I4} MOD_RES 350 350 Phosphoserine {ECO:0000250|UniProtKB:Q7TNY7} VAR_SEQ 1 187 Missing (in isoform 4) /FTId=VSP_043539 VAR_SEQ 1 112 MGRKLDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQ KLDEEGSKCSILSKHQQFVEHCCMRCCSPFTFLVNTKRQCG DCKFNVCKSCCSYQKHEKAWVCCVCQQARL -> MQKSLRP IGL (in isoform 3) /FTId=VSP_043540 VAR_SEQ 1 67 MGRKLDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQ KLDEEGSKCSILSKHQQFVEHCCMRC -> MRKAASAASSR STSSLWSTAACAAARPSPSSSTPSASVEIANSMSARAAAPT RSTKRPGSAASASKR (in isoform 6) /FTId=VSP_054896 VAR_SEQ 68 156 Missing (in isoform 6) /FTId=VSP_054897 VAR_SEQ 636 700 Missing (in isoform 2) /FTId=VSP_043541 VAR_SEQ 637 637 F -> S (in isoform 5) /FTId=VSP_043542 VAR_SEQ 638 859 Missing (in isoform 5) /FTId=VSP_043543 VARIANT 312 312 A -> T (in dbSNP:rs59923220) /FTId=VAR_061755 VARIANT 365 365 P -> L (in dbSNP:rs55785561) /FTId=VAR_061756 VARIANT 673 673 P -> S (in dbSNP:rs34800524) /FTId=VAR_051717 CONFLICT 130 130 K -> E (in Ref. 3; BAG54185) CONFLICT 529 529 R -> G (in Ref. 3; BAG54276) CONFLICT 536 536 E -> G (in Ref. 3; BAG54276) CONFLICT 571 571 D -> E (in Ref. 1; AAM43954) CONFLICT 773 773 A -> T (in Ref. 3; BAH14439) SEQUENCE 859 AA; 95706 MW; C1087932C405DFDD CRC64; MGRKLDLSGL TDDETEHVLQ VVQRDFNLRK KEEERLSELK QKLDEEGSKC SILSKHQQFV EHCCMRCCSP FTFLVNTKRQ CGDCKFNVCK SCCSYQKHEK AWVCCVCQQA RLLRAQSLEW FYNNVKSRFK RFGSAKVLKN LYRKHRLESG ACFDILGGSL FESNLENEGS ISGSDSTFYR QSEGHSVMDT LAVALRVAEE AIEEAISKAE AYGDSLDKQN EASYLRDHKE ELTEELATTI LQKIIRKQKS KSEQQVEEEP GWPHPQSCST KVADEGTSAS PGGYRAPAAL WRSQSAFSIT GEEALKTPPV EAPSRQPRDQ GQHPRAESAL PSWKSVDRLD ETNLAPVLQS PDGNWVALKD GAPPPTRLLA KPKSGTFQAL EVASSVASAY DEMGSDSEED FDWSEALSKL CPRSRALPRN PQPQPTQAQS SDQGPIAASP SSALSPNPEA MCSDSETSSA GSSREVGHQA RLSWLQRKAP RNPAAEKMRL HGELDVNFNP QLASRETSDS SEPEEAPHTT DRRARRWRRA RLGSEEPSKE PSSPSAQLRD LDTHQVSDDL SETDISNEAR DPQTLTDTTE EKRRNRLYEL AMKMSEKETS SGEDQESEPK TESENQKESL SSEDNSQSVQ EELKKKFSAV SLCNISTEVL KVINATEELI AGSTGPWESP QVPPDRQKGM FPRGTDQVRL DEQLTSLEEN VYLAAGTVYG LETQLTELED AARCIHSGTD ETHLADLEDQ VATAAAQVHH AELQISDIES RISALTIAGL NIAPCVRFTR RRDQKQRTQV QTIDTSRQQR RKLPAPPVKA EKIETSSVTT IKTFNHNFIL QGSSTNRTKE RKGTTKDLME PALESAVMY
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Rab effector protein involved in melanosome transport. Serves as link between melanosome-bound RAB27A and the motor proteins MYO5A and MYO7A. May link RAB27A-containing vesicles to actin filaments (By similarity).

References

Rose, J. Phd, et al. Mol. Med. (2010) In press :Nightingale, T.D., et al. Blood 113(20):5010-5018(2009)Hayasaka, S., et al. Asian J. Androl. 10(4):561-568(2008)Goehring, A.S., et al. J. Biol. Chem. 282(45):33155-33167(2007)Wu, C., et al. Proteomics 7(11):1775-1785(2007)

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 80.00
Cat# BP17165b
Size:
Quantity:
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions