Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   LBX1 Antibody (Center) Blocking Peptide   

LBX1 Antibody (Center) Blocking Peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession P52954
Clone Names 110729124
Peptide ID 110729124
Additional Information
Other Names Transcription factor LBX1, Ladybird homeobox protein homolog 1, LBX1, LBX1H
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name LBX1
Synonyms LBX1H
Function Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.
Cellular Location Nucleus. EMBL; X90828; CAA62342.1; -; mRNA EMBL; AL135794; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471066; EAW49777.1; -; Genomic_DNA EMBL; BC069156; AAH69156.1; -; mRNA EMBL; BC136321; AAI36322.1; -; mRNA CCDS; CCDS31270.1; - RefSeq; NP_006553.2; NM_006562.4 UniGene; Hs.37128; - ProteinModelPortal; P52954; - SMR; P52954; - BioGrid; 115903; 1 IntAct; P52954; 23 STRING; 9606.ENSP00000359212; - iPTMnet; P52954; - PhosphoSitePlus; P52954; - BioMuta; LBX1; - DMDM; 117949813; - PaxDb; P52954; - PeptideAtlas; P52954; - PRIDE; P52954; - ProteomicsDB; 56564; - Ensembl; ENST00000370193; ENSP00000359212; ENSG00000138136 GeneID; 10660; - KEGG; hsa:10660; - UCSC; uc001ksx.4; human CTD; 10660; - DisGeNET; 10660; - EuPathDB; HostDB:ENSG00000138136.6; - GeneCards; LBX1; - HGNC; HGNC:16960; LBX1 HPA; HPA002016; - HPA; HPA002086; - MIM; 604255; gene neXtProt; NX_P52954; - OpenTargets; ENSG00000138136; - PharmGKB; PA142671561; - eggNOG; KOG0488; Eukaryota eggNOG; ENOG411188D; LUCA GeneTree; ENSGT00910000143996; - HOGENOM; HOG000007247; - HOVERGEN; HBG006244; - InParanoid; P52954; - KO; K09353; - OMA; HTTSKEC; - OrthoDB; EOG091G09CY; - PhylomeDB; P52954; - TreeFam; TF325047; - SIGNOR; P52954; - GeneWiki; LBX1; - GenomeRNAi; 10660; - PRO; PR:P52954; - Proteomes; UP000005640; Chromosome 10 Bgee; ENSG00000138136; - CleanEx; HS_LBX1; - Genevisible; P52954; HS GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell GO; GO:0005667; C:transcription factor complex; IEA:Ensembl GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; ISA:NTNU_SB GO; GO:0043565; F:sequence-specific DNA binding; IEA:InterPro GO; GO:0009653; P:anatomical structure morphogenesis; TAS:ProtInc GO; GO:0001947; P:heart looping; IEA:Ensembl GO; GO:0007517; P:muscle organ development; IEA:UniProtKB-KW GO; GO:0008285; P:negative regulation of cell proliferation; IEA:Ensembl GO; GO:0045665; P:negative regulation of neuron differentiation; IEA:Ensembl GO; GO:0048664; P:neuron fate determination; IEA:Ensembl GO; GO:0021920; P:regulation of transcription from RNA polymerase II promoter involved in spinal cord association neuron specification; IEA:Ensembl GO; GO:0021522; P:spinal cord motor neuron differentiation; IEA:Ensembl GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW CDD; cd00086; homeodomain; 1 InterPro; IPR009057; Homeobox-like_sf InterPro; IPR017970; Homeobox_CS InterPro; IPR001356; Homeobox_dom InterPro; IPR000047; HTH_motif Pfam; PF00046; Homeobox; 1 PRINTS; PR00031; HTHREPRESSR SMART; SM00389; HOX; 1 SUPFAM; SSF46689; SSF46689; 1 PROSITE; PS00027; HOMEOBOX_1; 1 PROSITE; PS50071; HOMEOBOX_2; 1 2: Evidence at transcript level; Complete proteome; Developmental protein; Differentiation; DNA-binding; Homeobox; Myogenesis; Neurogenesis; Nucleus; Reference proteome; Transcription; Transcription regulation CHAIN 1 281 Transcription factor LBX1 /FTId=PRO_0000049166 DNA_BIND 125 184 Homeobox. {ECO:0000255|PROSITE- ProRule:PRU00108} COMPBIAS 220 226 Poly-Gly COMPBIAS 270 281 Asp/Glu-rich (highly acidic) CONFLICT 33 72 LTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGGLP -> YAVQHRGHPQQAVRAEKLLAAWGGAPAGRRGQARAGRL A (in Ref. 1; CAA62342). CONFLICT 81 81 Q -> K (in Ref. 1; CAA62342) CONFLICT 183 183 D -> E (in Ref. 1; CAA62342) CONFLICT 194 194 A -> P (in Ref. 1; CAA62342) CONFLICT 247 248 AG -> RC (in Ref. 1; CAA62342) SEQUENCE 281 AA; 30221 MW; 8467F2B515681CCA CRC64; MTSKEDGKAA PGEERRRSPL DHLPPPANSN KPLTPFSIED ILNKPSVRRS YSLCGAAHLL AAADKHAQGG LPLAGRALLS QTSPLCALEE LASKTFKGLE VSVLQAAEGR DGMTIFGQRQ TPKKRRKSRT AFTNHQIYEL EKRFLYQKYL SPADRDQIAQ QLGLTNAQVI TWFQNRRAKL KRDLEEMKAD VESAKKLGPS GQMDIVALAE LEQNSEATAG GGGGCGRAKS RPGSPVLPPG APKAPGAGAL QLSPASPLTD QPASSQDCSE DEEDEEIDVD D
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

This gene and the orthologous mouse gene were found bytheir homology to the Drosophila lady bird early and late homeoboxgenes. In the mouse, this gene is a key regulator of muscleprecursor cell migration and is required for the acquisition ofdorsal identities of forelimb muscles.

References

Yu, M., et al. Genes Dev. 23(15):1737-1742(2009)Deloukas, P., et al. Nature 429(6990):375-381(2004)de Mollerat, X.J., et al. Hum. Mol. Genet. 12(16):1959-1971(2003)Kozmik, Z., et al. Genesis 29(4):172-179(2001)Jagla, K., et al. Mech. Dev. 53(3):345-356(1995)

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 80.00
Cat# BP18241c
Size:
Quantity:
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions