Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   NICN1 Blocking Peptide (C-term)   

NICN1 Blocking Peptide (C-term)

Synthetic peptide

Product Information
Primary Accession Q9BSH3
Other Accession NP_115692.1
Additional Information
Other Names Nicolin-1, NPCEDRG, Tubulin polyglutamylase complex subunit 5, PGs5, NICN1
Target/Specificity The synthetic peptide sequence is selected from aa 163-176 of HUMAN NICN1
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name NICN1
Cellular Location Nucleus.
Tissue Location High expression level is found in brain, testis, liver and kidney. Weak expression in spleen, leukocytes, small intestine and colon. EMBL; AJ299740; CAC82516.1; -; mRNA EMBL; AF538150; AAN52734.1; -; mRNA EMBL; BC005050; AAH05050.1; -; mRNA EMBL; BC050653; AAH50653.1; -; mRNA CCDS; CCDS2798.1; -. [Q9BSH3-1] RefSeq; NP_115692.1; NM_032316.3. [Q9BSH3-1] UniGene; Hs.191460; - ProteinModelPortal; Q9BSH3; - BioGrid; 124003; 9 STRING; 9606.ENSP00000273598; - iPTMnet; Q9BSH3; - PhosphoSitePlus; Q9BSH3; - BioMuta; NICN1; - DMDM; 51701690; - PaxDb; Q9BSH3; - PRIDE; Q9BSH3; - DNASU; 84276; - Ensembl; ENST00000273598; ENSP00000273598; ENSG00000145029. [Q9BSH3-1] Ensembl; ENST00000423832; ENSP00000413115; ENSG00000145029. [Q9BSH3-1] GeneID; 84276; - KEGG; hsa:84276; - UCSC; uc003cwz.2; human. [Q9BSH3-1] CTD; 84276; - DisGeNET; 84276; - GeneCards; NICN1; - HGNC; HGNC:18317; NICN1 HPA; HPA037550; - MIM; 611516; gene neXtProt; NX_Q9BSH3; - OpenTargets; ENSG00000145029; - OpenTargets; ENSG00000283189; - PharmGKB; PA31623; - eggNOG; ENOG410IHPW; Eukaryota eggNOG; ENOG4111GDK; LUCA GeneTree; ENSGT00390000001505; - HOGENOM; HOG000006705; - HOVERGEN; HBG052619; - InParanoid; Q9BSH3; - KO; K16607; - OMA; CDMARVL; - OrthoDB; EOG091G0NXM; - PhylomeDB; Q9BSH3; - TreeFam; TF329753; - BioCyc; ZFISH:ENSG00000145029-MONOMER; - ChiTaRS; NICN1; human GenomeRNAi; 84276; - PRO; PR:Q9BSH3; - Proteomes; UP000005640; Chromosome 3 Bgee; ENSG00000145029; - CleanEx; HS_NICN1; - ExpressionAtlas; Q9BSH3; baseline and differential Genevisible; Q9BSH3; HS GO; GO:0005874; C:microtubule; IEA:UniProtKB-KW GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell 2: Evidence at transcript level; Alternative splicing; Complete proteome; Microtubule; Nucleus; Reference proteome CHAIN 1 213 Nicolin-1 /FTId=PRO_0000096814 VAR_SEQ 166 213 GLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYD LNLLSYT -> VSPHPR (in isoform 2) {ECO:0000303|Ref.2} /FTId=VSP_011420 CONFLICT 45 46 Missing (in Ref. 2; AAN52734) SEQUENCE 213 AA; 24202 MW; 2170A24989952652 CRC64; MSRVLVPCHV KGSVALQVGD VRTSQGRPGV LVIDVTFPSV APFELQEITF KNYYTAFLSI RVRQYTSAHT PAKWVTCLRD YCLMPDPHSE EGAQEYVSLF KHQMLCDMAR ISELRLILRQ PSPLWLSFTV EELQIYQQGP KSPSVTFPKW LSHPVPCEQP ALLREGLPDP SRVSSEVQQM WALTEMIRAS HTSARIGRFD VDGCYDLNLL SYT
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


This protein encoded by this gene localizes to the nucleus and is expressed in numerous tissues including brain, testis, liver, and kidney. This refseq contains genomic sequence in its 3' UTR which is not supported by experimental evidence. Computer predictions indicate that this region of the 3' UTR contains hairpin-forming self-complementary sequence which is possibly excised after transcription. This gene has a pseudogene on chromosome X.


Guey, L.T., et al. Eur. Urol. 57(2):283-292(2010)
Backofen, B., et al. Eur. J. Biochem. 269(21):5240-5245(2002)
Backofen, B., et al. DNA Seq. 13(4):179-183(2002)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 80.00
Cat# BP5384b
Availability: 2 weeks
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Terms & Conditions