Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   OLFM3 Antibody (Center) Blocking Peptide   

OLFM3 Antibody (Center) Blocking Peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession Q96PB7
Clone Names 6020668
Additional Information
Other Names Noelin-3, Olfactomedin-3, Optimedin, OLFM3, NOE3
Target/Specificity The synthetic peptide sequence used to generate the antibody AP7736c was selected from the Center region of human OLFM3. A 10 to 100 fold molar excess to antibody is recommended. Precise conditions should be optimized for a particular assay.
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name OLFM3
Synonyms NOE3
Cellular Location Secreted. Cell junction, synapse
Tissue Location In the eye, expressed in trabecular meshwork and neural retina; in non-ocular tissues, expressed in brain and lung. EMBL; AF397392; AAK97473.1; -; mRNA EMBL; AF397393; AAK97474.1; -; mRNA EMBL; AF397394; AAK97475.1; -; mRNA EMBL; AF397395; AAK97476.1; -; mRNA EMBL; AF397396; AAK97477.1; -; mRNA EMBL; AF397397; AAK97478.1; -; mRNA EMBL; AY358722; AAQ89084.1; -; mRNA EMBL; AK095724; BAG53115.1; -; mRNA EMBL; AL356280; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL359760; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471097; EAW72922.1; -; Genomic_DNA EMBL; BC022531; AAH22531.1; -; mRNA EMBL; BK001429; DAA01551.1; -; Genomic_DNA EMBL; BK001429; DAA01553.1; -; Genomic_DNA EMBL; BK001429; DAA01554.1; -; Genomic_DNA EMBL; BK001429; DAA01555.1; -; Genomic_DNA EMBL; BK001429; DAA01556.1; -; Genomic_DNA CCDS; CCDS30781.1; -. [Q96PB7-3] CCDS; CCDS72832.1; -. [Q96PB7-1] RefSeq; NP_001275750.1; NM_001288821.1. [Q96PB7-1] RefSeq; NP_001275752.1; NM_001288823.1. [Q96PB7-5] RefSeq; NP_477518.2; NM_058170.3. [Q96PB7-3] RefSeq; XP_016855729.1; XM_017000240.1. [Q96PB7-5] UniGene; Hs.484475; - ProteinModelPortal; Q96PB7; - SMR; Q96PB7; - BioGrid; 125601; 10 IntAct; Q96PB7; 6 STRING; 9606.ENSP00000359121; - iPTMnet; Q96PB7; - PhosphoSitePlus; Q96PB7; - DMDM; 20139068; - PaxDb; Q96PB7; - PeptideAtlas; Q96PB7; - PRIDE; Q96PB7; - ProteomicsDB; 77652; - ProteomicsDB; 77653; -. [Q96PB7-2] ProteomicsDB; 77654; -. [Q96PB7-3] ProteomicsDB; 77655; -. [Q96PB7-4] ProteomicsDB; 77656; -. [Q96PB7-5] ProteomicsDB; 77657; -. [Q96PB7-6] DNASU; 118427; - Ensembl; ENST00000338858; ENSP00000345192; ENSG00000118733. [Q96PB7-1] Ensembl; ENST00000370103; ENSP00000359121; ENSG00000118733. [Q96PB7-3] Ensembl; ENST00000536598; ENSP00000443471; ENSG00000118733. [Q96PB7-6] GeneID; 118427; - KEGG; hsa:118427; - UCSC; uc001duf.4; human. [Q96PB7-1] CTD; 118427; - DisGeNET; 118427; - EuPathDB; HostDB:ENSG00000118733.16; - GeneCards; OLFM3; - H-InvDB; HIX0000823; - HGNC; HGNC:17990; OLFM3 HPA; HPA050297; - MIM; 607567; gene neXtProt; NX_Q96PB7; - OpenTargets; ENSG00000118733; - PharmGKB; PA31917; - eggNOG; ENOG410INP6; Eukaryota eggNOG; ENOG410ZVS0; LUCA GeneTree; ENSGT00760000119005; - HOGENOM; HOG000232069; - HOVERGEN; HBG061751; - InParanoid; Q96PB7; - OMA; VMKSWNT; - OrthoDB; EOG091G05HN; - PhylomeDB; Q96PB7; - TreeFam; TF315964; - ChiTaRS; OLFM3; human GeneWiki; OLFM3; - GenomeRNAi; 118427; - PRO; PR:Q96PB7; - Proteomes; UP000005640; Chromosome 1 Bgee; ENSG00000118733; - CleanEx; HS_OLFM3; - ExpressionAtlas; Q96PB7; baseline and differential Genevisible; Q96PB7; HS GO; GO:0032281; C:AMPA glutamate receptor complex; IEA:Ensembl GO; GO:0030054; C:cell junction; IEA:UniProtKB-KW GO; GO:0005615; C:extracellular space; IEA:Ensembl GO; GO:0005794; C:Golgi apparatus; IEA:Ensembl GO; GO:0045202; C:synapse; IEA:UniProtKB-SubCell GO; GO:0042462; P:eye photoreceptor cell development; IEA:Ensembl InterPro; IPR031216; Noelin-3 InterPro; IPR022082; Noelin_dom InterPro; IPR003112; Olfac-like_dom InterPro; IPR011044; Quino_amine_DH_bsu PANTHER; PTHR23192:SF36; PTHR23192:SF36; 1 Pfam; PF12308; Noelin-1; 1 Pfam; PF02191; OLF; 1 SMART; SM00284; OLF; 1 SUPFAM; SSF50969; SSF50969; 3 PROSITE; PS51132; OLF; 1 1: Evidence at protein level; Alternative splicing; Cell junction; Coiled coil; Complete proteome; Disulfide bond; Glycoprotein; Reference proteome; Secreted; Signal; Synapse SIGNAL 1 23 CHAIN 24 478 Noelin-3 /FTId=PRO_0000020080 DOMAIN 218 470 Olfactomedin-like. {ECO:0000255|PROSITE- ProRule:PRU00446} COILED 77 217 CARBOHYD 33 33 N-linked (GlcNAc...) asparagine CARBOHYD 95 95 N-linked (GlcNAc...) asparagine CARBOHYD 179 179 N-linked (GlcNAc...) asparagine CARBOHYD 299 299 N-linked (GlcNAc...) asparagine CARBOHYD 465 465 N-linked (GlcNAc...) asparagine DISULFID 219 401 {ECO:0000255|PROSITE-ProRule:PRU00446} VAR_SEQ 1 95 Missing (in isoform 5 and isoform 6) {ECO:0000303|Ref.1} /FTId=VSP_003770 VAR_SEQ 1 43 MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPD TL -> MQATSNLLNLLLLSLFAGLDPSK (in isoform 3 and isoform 4) {ECO:0000303|PubMed:15489334, ECO:0000303|Ref.1} /FTId=VSP_003769 VAR_SEQ 218 235 TCGKLMKITGPVTVKTSG -> IDLKKRKEEEKRQQKGEA (in isoform 2, isoform 4 and isoform 6) {ECO:0000303|Ref.1} /FTId=VSP_003771 VAR_SEQ 236 478 Missing (in isoform 2, isoform 4 and isoform 6). {ECO:0000303|Ref.1} /FTId=VSP_003772 CONFLICT 88 88 Q -> K (in Ref. 6; AAH22531) CONFLICT 454 454 Y -> C (in Ref. 6; AAH22531) SEQUENCE 478 AA; 54930 MW; 02EAAF58741489E5 CRC64; MSPPLLKLGA VLSTMAMISN WMSQTLPSLV GLNTTRLSTP DTLTQISPKE GWQVYSSAQD PDGRCICTVV APEQNLCSRD AKSRQLRQLL EKVQNMSQSI EVLNLRTQRD FQYVLKMETQ MKGLKAKFRQ IEDDRKTLMT KHFQELKEKM DELLPLIPVL EQYKTDAKLI TQFKEEIRNL SAVLTGIQEE IGAYDYEELH QRVLSLETRL RDCMKKLTCG KLMKITGPVT VKTSGTRFGA WMTDPLASEK NNRVWYMDSY TNNKIVREYK SIADFVSGAE SRTYNLPFKW AGTNHVVYNG SLYFNKYQSN IIIKYSFDMG RVLAQRSLEY AGFHNVYPYT WGGFSDIDLM ADEIGLWAVY ATNQNAGNIV ISQLNQDTLE VMKSWSTGYP KRSAGESFMI CGTLYVTNSH LTGAKVYYSY STKTSTYEYT DIPFHNQYFH ISMLDYNARD RALYAWNNGH QVLFNVTLFH IIKTEDDT
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

OLFM3 may be involved in disorders involving the anterior segment of the eye and the retina.

References

Grinchuk,O., J. Biol. Chem. 280 (42), 35228-35237 (2005)Torrado,M., Hum. Mol. Genet. 11 (11), 1291-1301 (2002)

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 80.00
Cat# BP7736c
Size:
Quantity:
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions