Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   ANGPT4 Antibody (N-term) Blocking Peptide   

ANGPT4 Antibody (N-term) Blocking Peptide

Synthetic peptide

Product Information
Primary Accession Q9Y264
Clone Names 80311203
Peptide ID 80311203
Additional Information
Other Names Angiopoietin-4, ANG-4, Angiopoietin-3, ANG-3, ANGPT4, ANG3, ANG4
Target/Specificity The synthetic peptide sequence used to generate the antibody AP7866a was selected from the N-term region of human ANGPT4. A 10 to 100 fold molar excess to antibody is recommended. Precise conditions should be optimized for a particular assay.
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Synonyms ANG3, ANG4
Function Binds to TEK/TIE2, modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2. Promotes endothelial cell survival, migration and angiogenesis.
Cellular Location Secreted.
Tissue Location Highly expressed in the lung with much lower levels found in other tissues EMBL; AF074332; AAD31728.1; -; mRNA EMBL; AF113708; AAD21587.1; -; mRNA EMBL; AK304756; BAG65511.1; -; mRNA EMBL; AL050325; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; AL161939; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC111976; AAI11977.1; -; mRNA EMBL; BC111978; AAI11979.1; -; mRNA CCDS; CCDS13009.1; -. [Q9Y264-1] RefSeq; NP_001309738.1; NM_001322809.1. [Q9Y264-2] RefSeq; NP_057069.1; NM_015985.3. [Q9Y264-1] UniGene; Hs.278973; - UniGene; Hs.565714; - ProteinModelPortal; Q9Y264; - SMR; Q9Y264; - BioGrid; 119510; 3 IntAct; Q9Y264; 1 STRING; 9606.ENSP00000371347; - iPTMnet; Q9Y264; - PhosphoSitePlus; Q9Y264; - BioMuta; ANGPT4; - DMDM; 17433288; - EPD; Q9Y264; - PaxDb; Q9Y264; - PeptideAtlas; Q9Y264; - PRIDE; Q9Y264; - ProteomicsDB; 85668; - DNASU; 51378; - Ensembl; ENST00000381922; ENSP00000371347; ENSG00000101280. [Q9Y264-1] GeneID; 51378; - KEGG; hsa:51378; - UCSC; uc002wei.4; human. [Q9Y264-1] CTD; 51378; - DisGeNET; 51378; - EuPathDB; HostDB:ENSG00000101280.7; - GeneCards; ANGPT4; - HGNC; HGNC:487; ANGPT4 HPA; CAB013260; - HPA; CAB013305; - MIM; 603705; gene neXtProt; NX_Q9Y264; - OpenTargets; ENSG00000101280; - PharmGKB; PA24793; - eggNOG; KOG2579; Eukaryota eggNOG; ENOG410ZYS4; LUCA GeneTree; ENSGT00920000148944; - HOGENOM; HOG000037128; - HOVERGEN; HBG001644; - InParanoid; Q9Y264; - KO; K05467; - OMA; GIRWHYF; - OrthoDB; EOG091G03M1; - PhylomeDB; Q9Y264; - TreeFam; TF336658; - Reactome; R-HSA-210993; Tie2 Signaling SignaLink; Q9Y264; - SIGNOR; Q9Y264; - GeneWiki; ANGPT4; - GenomeRNAi; 51378; - PRO; PR:Q9Y264; - Proteomes; UP000005640; Chromosome 20 Bgee; ENSG00000101280; - CleanEx; HS_ANGPT4; - Genevisible; Q9Y264; HS GO; GO:0005576; C:extracellular region; TAS:Reactome GO; GO:0005615; C:extracellular space; IDA:UniProtKB GO; GO:0030971; F:receptor tyrosine kinase binding; IDA:UniProtKB GO; GO:0030297; F:transmembrane receptor protein tyrosine kinase activator activity; IDA:UniProtKB GO; GO:0001525; P:angiogenesis; IEA:UniProtKB-KW GO; GO:0071456; P:cellular response to hypoxia; IEP:UniProtKB GO; GO:0050900; P:leukocyte migration; TAS:Reactome GO; GO:0016525; P:negative regulation of angiogenesis; IDA:UniProtKB GO; GO:0043066; P:negative regulation of apoptotic process; IDA:UniProtKB GO; GO:0043537; P:negative regulation of blood vessel endothelial cell migration; IDA:UniProtKB GO; GO:0007219; P:Notch signaling pathway; IEA:Ensembl GO; GO:0045766; P:positive regulation of angiogenesis; IDA:UniProtKB GO; GO:0043536; P:positive regulation of blood vessel endothelial cell migration; IDA:UniProtKB GO; GO:0010595; P:positive regulation of endothelial cell migration; IDA:UniProtKB GO; GO:0050731; P:positive regulation of peptidyl-tyrosine phosphorylation; IDA:UniProtKB CDD; cd00087; FReD; 1 Gene3D;; -; 2 Gene3D; 4.10.530.10; -; 1 InterPro; IPR028845; Ang-4 InterPro; IPR036056; Fibrinogen-like_C InterPro; IPR014716; Fibrinogen_a/b/g_C_1 InterPro; IPR014715; Fibrinogen_a/b/g_C_2 InterPro; IPR002181; Fibrinogen_a/b/g_C_dom InterPro; IPR020837; Fibrinogen_CS PANTHER; PTHR19143:SF31; PTHR19143:SF31; 1 Pfam; PF00147; Fibrinogen_C; 1 SMART; SM00186; FBG; 1 SUPFAM; SSF56496; SSF56496; 1 PROSITE; PS00514; FIBRINOGEN_C_1; 1 PROSITE; PS51406; FIBRINOGEN_C_2; 1 1: Evidence at protein level; Alternative splicing; Angiogenesis; Coiled coil; Complete proteome; Disulfide bond; Glycoprotein; Polymorphism; Reference proteome; Secreted; Signal SIGNAL 1 24 CHAIN 25 503 Angiopoietin-4 /FTId=PRO_0000009116 DOMAIN 282 502 Fibrinogen C-terminal {ECO:0000255|PROSITE-ProRule:PRU00739} COILED 84 238 CARBOHYD 96 96 N-linked (GlcNAc...) asparagine CARBOHYD 126 126 N-linked (GlcNAc...) asparagine CARBOHYD 140 140 N-linked (GlcNAc...) asparagine CARBOHYD 158 158 N-linked (GlcNAc...) asparagine CARBOHYD 247 247 N-linked (GlcNAc...) asparagine CARBOHYD 274 274 N-linked (GlcNAc...) asparagine CARBOHYD 311 311 N-linked (GlcNAc...) asparagine CARBOHYD 337 337 N-linked (GlcNAc...) asparagine CARBOHYD 427 427 N-linked (GlcNAc...) asparagine DISULFID 291 320 {ECO:0000255|PROSITE-ProRule:PRU00739} DISULFID 444 457 {ECO:0000255|PROSITE-ProRule:PRU00739} VAR_SEQ 408 503 LSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVM SGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSY SLRASRMMIRPLDI -> VVV (in isoform 2) /FTId=VSP_055091 VARIANT 395 395 E -> K (in dbSNP:rs869171) /FTId=VAR_049070 SEQUENCE 503 AA; 56849 MW; 79CE52F66B532340 CRC64; MLSQLAMLQG SLLLVVATMS VAQQTRQEAD RGCETLVVQH GHCSYTFLLP KSEPCPPGPE VSRDSNTLQR ESLANPLHLG KLPTQQVKQL EQALQNNTQW LKKLERAIKT ILRSKLEQVQ QQMAQNQTAP MLELGTSLLN QTTAQIRKLT DMEAQLLNQT SRMDAQMPET FLSTNKLENQ LLLQRQKLQQ LQGQNSALEK RLQALETKQQ EELASILSKK AKLLNTLSRQ SAALTNIERG LRGVRHNSSL LQDQQHSLRQ LLVLLRHLVQ ERANASAPAF IMAGEQVFQD CAEIQRSGAS ASGVYTIQVS NATKPRKVFC DLQSSGGRWT LIQRRENGTV NFQRNWKDYK QGFGDPAGEH WLGNEVVHQL TRRAAYSLRV ELQDWEGHEA YAQYEHFHLG SENQLYRLSV VGYSGSAGRQ SSLVLQNTSF STLDSDNDHC LCKCAQVMSG GWWFDACGLS NLNGVYYHAP DNKYKMDGIR WHYFKGPSYS LRASRMMIRP LDI
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


ANGPT4 is a protein with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis is thought to involve regulation of endothelial cell interactions with supporting perivascular cells. The protein functions as an agonist and is an angiopoietin.


Valenzuela D.M., Griffiths J.A.. Natl. Acad. Sci. U.S.A. 96:1904-1909(1999)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 80.00
Cat# BP7866a
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions