Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   TGOLN2 Antibody (C-term) Blocking Peptide   

TGOLN2 Antibody (C-term) Blocking Peptide

Synthetic peptide

Product Information
Primary Accession O43493
Clone Names 90909107
Peptide ID 90909107
Additional Information
Other Names Trans-Golgi network integral membrane protein 2, TGN38 homolog, TGN46, TGN48, Trans-Golgi network protein TGN51, TGOLN2, TGN46, TGN51
Target/Specificity The synthetic peptide sequence used to generate the antibody AP8955b was selected from the C-term region of human TGOLN2. A 10 to 100 fold molar excess to antibody is recommended. Precise conditions should be optimized for a particular assay.
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Synonyms TGN46, TGN51
Function May be involved in regulating membrane traffic to and from trans-Golgi network.
Cellular Location Cell membrane; Single-pass type I membrane protein. Golgi apparatus, trans-Golgi network membrane; Single- pass type I membrane protein. Note=Primarily in trans-Golgi network. Cycles between the trans-Golgi network and the cell surface returning via endosomes
Tissue Location Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells EMBL; AF029316; AAB96906.1; -; Genomic_DNA EMBL; AF029313; AAB96906.1; JOINED; Genomic_DNA EMBL; AF029314; AAB96906.1; JOINED; Genomic_DNA EMBL; AF029315; AAB96906.1; JOINED; Genomic_DNA EMBL; AF029316; AAB96907.1; -; Genomic_DNA EMBL; AF029313; AAB96907.1; JOINED; Genomic_DNA EMBL; AF029314; AAB96907.1; JOINED; Genomic_DNA EMBL; AF029315; AAB96907.1; JOINED; Genomic_DNA EMBL; AF029316; AAB96908.1; -; Genomic_DNA EMBL; AF029313; AAB96908.1; JOINED; Genomic_DNA EMBL; AF029314; AAB96908.1; JOINED; Genomic_DNA EMBL; AF029315; AAB96908.1; JOINED; Genomic_DNA EMBL; U62390; AAC39539.1; -; mRNA EMBL; AF027515; AAC39541.1; -; mRNA EMBL; AF027516; AAC39542.1; -; mRNA EMBL; X94333; CAA64002.1; -; mRNA EMBL; AK126465; BAC86559.1; -; mRNA EMBL; AK222829; BAD96549.1; -; mRNA EMBL; AK223063; BAD96783.1; -; mRNA EMBL; AK312479; BAG35383.1; -; mRNA EMBL; BX640868; CAE45926.1; -; mRNA EMBL; AC093162; AAY24095.1; -; Genomic_DNA EMBL; CH471053; EAW99535.1; -; Genomic_DNA EMBL; CH471053; EAW99536.1; -; Genomic_DNA EMBL; CH471053; EAW99539.1; -; Genomic_DNA EMBL; BC008461; AAH08461.1; -; mRNA EMBL; BC028219; AAH28219.1; -; mRNA CCDS; CCDS46351.1; -. [O43493-2] CCDS; CCDS56126.1; -. [O43493-3] CCDS; CCDS56127.1; -. [O43493-4] RefSeq; NP_001193769.1; NM_001206840.1 RefSeq; NP_001193770.1; NM_001206841.1 RefSeq; NP_001193773.1; NM_001206844.1. [O43493-4] RefSeq; NP_006455.2; NM_006464.3. [O43493-2] UniGene; Hs.593382; - ProteinModelPortal; O43493; - BioGrid; 115864; 50 IntAct; O43493; 19 MINT; MINT-3372343; - STRING; 9606.ENSP00000386443; - iPTMnet; O43493; - PhosphoSitePlus; O43493; - BioMuta; TGOLN2; - EPD; O43493; - MaxQB; O43493; - PaxDb; O43493; - PeptideAtlas; O43493; - PRIDE; O43493; - DNASU; 10618; - Ensembl; ENST00000377386; ENSP00000366603; ENSG00000152291. [O43493-2] Ensembl; ENST00000398263; ENSP00000381312; ENSG00000152291. [O43493-4] Ensembl; ENST00000409232; ENSP00000386443; ENSG00000152291. [O43493-3] Ensembl; ENST00000444342; ENSP00000391190; ENSG00000152291. [O43493-5] GeneID; 10618; - KEGG; hsa:10618; - UCSC; uc002soz.4; human. [O43493-1] CTD; 10618; - DisGeNET; 10618; - GeneCards; TGOLN2; - H-InvDB; HIX0022878; - HGNC; HGNC:15450; TGOLN2 HPA; CAB011489; - HPA; HPA012609; - HPA; HPA012723; - MIM; 603062; gene neXtProt; NX_O43493; - OpenTargets; ENSG00000152291; - PharmGKB; PA37959; - eggNOG; ENOG410IXPE; Eukaryota eggNOG; ENOG410XUUR; LUCA GeneTree; ENSGT00530000064712; - HOGENOM; HOG000089969; - HOVERGEN; HBG108564; - InParanoid; O43493; - PhylomeDB; O43493; - BioCyc; ZFISH:ENSG00000152291-MONOMER; - Reactome; R-HSA-432722; Golgi Associated Vesicle Biogenesis Reactome; R-HSA-6811440; Retrograde transport at the Trans-Golgi-Network Reactome; R-HSA-8856825; Cargo recognition for clathrin-mediated endocytosis Reactome; R-HSA-8856828; Clathrin-mediated endocytosis ChiTaRS; TGOLN2; human GeneWiki; TGOLN2; - GenomeRNAi; 10618; - PRO; PR:O43493; - Proteomes; UP000005640; Chromosome 2 Bgee; ENSG00000152291; - ExpressionAtlas; O43493; baseline and differential Genevisible; O43493; HS GO; GO:0005829; C:cytosol; IEA:GOC GO; GO:0005768; C:endosome; IBA:GO_Central GO; GO:0005794; C:Golgi apparatus; IDA:HPA GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW GO; GO:0005654; C:nucleoplasm; IDA:HPA GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell GO; GO:0005802; C:trans-Golgi network; IDA:MGI GO; GO:0032588; C:trans-Golgi network membrane; TAS:Reactome GO; GO:0030140; C:trans-Golgi network transport vesicle; IBA:GO_Central GO; GO:0030133; C:transport vesicle; TAS:Reactome GO; GO:0006895; P:Golgi to endosome transport; IBA:GO_Central InterPro; IPR026084; TGN38 PANTHER; PTHR23211; PTHR23211; 1 1: Evidence at protein level; Alternative splicing; Cell membrane; Complete proteome; Glycoprotein; Golgi apparatus; Membrane; Phosphoprotein; Polymorphism; Reference proteome; Repeat; Signal; Transmembrane; Transmembrane helix SIGNAL 1 21 CHAIN 22 480 Trans-Golgi network integral membrane protein 2 /FTId=PRO_0000022486 TOPO_DOM 22 381 Extracellular. TRANSMEM 382 402 Helical. TOPO_DOM 403 480 Cytoplasmic. REPEAT 54 67 1 REPEAT 68 81 2 REPEAT 82 95 3 REPEAT 96 109 4 REPEAT 110 123 5 REPEAT 124 137 6 REPEAT 138 151 7 REPEAT 152 165 8 REPEAT 166 179 9 REPEAT 180 193 10 REPEAT 194 207 11 REPEAT 208 221 12 REPEAT 222 234 13 REPEAT 235 249 14 REGION 54 249 14 X 14 AA tandem repeats MOTIF 430 433 Endocytosis signal; in isoform TGN46 and isoform TGN48 MOTIF 437 440 Endocytosis signal; in isoform TGN51 MOTIF 461 464 Endocytosis signal; in isoform TGN51 MOD_RES 71 71 Phosphoserine; by FAM20C MOD_RES 221 221 Phosphoserine; by FAM20C MOD_RES 298 298 Phosphoserine; by FAM20C MOD_RES 302 302 Phosphothreonine; by FAM20C MOD_RES 351 351 Phosphoserine; by FAM20C CARBOHYD 39 39 N-linked (GlcNAc...). CARBOHYD 82 82 N-linked (GlcNAc...). CARBOHYD 96 96 N-linked (GlcNAc...). CARBOHYD 152 152 N-linked (GlcNAc...). CARBOHYD 180 180 N-linked (GlcNAc...). CARBOHYD 208 208 N-linked (GlcNAc...). CARBOHYD 222 222 N-linked (GlcNAc...). CARBOHYD 373 373 N-linked (GlcNAc...). CARBOHYD 377 377 N-linked (GlcNAc...). VAR_SEQ 64 161 Missing (in isoform 6) /FTId=VSP_027469 VAR_SEQ 252 309 Missing (in isoform 4 and isoform 6) /FTId=VSP_027470 VAR_SEQ 437 480 YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLS FQL -> VRKEEPGPWEG (in isoform 5) /FTId=VSP_027471 VAR_SEQ 437 480 YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLS FQL -> S (in isoform TGN46, isoform 4 and isoform 6). {ECO:0000303|PubMed:14702039, ECO:0000303|PubMed:15489334, ECO:0000303|PubMed:17974005, ECO:0000303|PubMed:8907712, ECO:0000303|PubMed:9422759, ECO:0000303|Ref.4} /FTId=VSP_004454 VAR_SEQ 437 480 YVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLS FQL -> IFFPLSPNRMVYSSGKR (in isoform TGN48). /FTId=VSP_004455 VARIANT 10 10 L -> V (in dbSNP:rs1128140) /FTId=VAR_034724 VARIANT 86 86 A -> G (in dbSNP:rs1044962) /FTId=VAR_034725 VARIANT 91 91 Q -> L (in dbSNP:rs1044963) /FTId=VAR_034726 VARIANT 103 103 K -> Q (in dbSNP:rs1044964) /FTId=VAR_034727 VARIANT 105 105 Q -> P (in dbSNP:rs1044965) /FTId=VAR_034728 VARIANT 259 259 R -> W (in dbSNP:rs4247303) {ECO:0000269|PubMed:14702039, ECO:0000269|PubMed:8907712, ECO:0000269|Ref.4, ECO:0000269|Ref.7} /FTId=VAR_034729 VARIANT 322 322 E -> G (in dbSNP:rs1044969) /FTId=VAR_034730 MUTAGEN 430 430 Y->A: Loss of relocalization to the trans-Golgi CONFLICT 30 30 E -> D (in Ref. 8; AAH08461) CONFLICT 71 71 S -> G (in Ref. 4; BAD96549) CONFLICT 74 74 A -> P (in Ref. 4; BAD96783) CONFLICT 158 158 A -> P (in Ref. 1; AAB96906/AAB96907/ AAB96908/AAC39539/AAC39541/AAC39542) CONFLICT 386 386 F -> S (in Ref. 5; CAE45926) CONFLICT 453 453 L -> F (in Ref. 7; EAW99536/EAW99539) SEQUENCE 480 AA; 51113 MW; 070F6287D35D3601 CRC64; MRFVVALVLL NVAAAGAVPL LATESVKQEE AGVRPSAGNV STHPSLSQRP GGSTKSHPEP QTPKDSPSKS SAEAQTPEDT PNKSGAEAKT QKDSSNKSGA EAKTQKGSTS KSGSEAQTTK DSTSKSHPEL QTPKDSTGKS GAEAQTPEDS PNRSGAEAKT QKDSPSKSGS EAQTTKDVPN KSGADGQTPK DGSSKSGAED QTPKDVPNKS GAEKQTPKDG SNKSGAEEQG PIDGPSKSGA EEQTSKDSPN KVVPEQPSRK DHSKPISNPS DNKELPKADT NQLADKGKLS PHAFKTESGE ETDLISPPQE EVKSSEPTED VEPKEAEDDD TGPEEGSPPK EEKEKMSGSA SSENREGTLS DSTGSEKDDL YPNGSGNGSA ESSHFFAYLV TAAILVAVLY IAHHNKRKII AFVLEGKRSK VTRRPKASDY QRLDQKYVLI LNVFPAPPKR SFLPQVLTEW YIPLEKDERH QWIVLLSFQL
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


TGOLN2 may be involved in regulating membrane traffic to and from trans-Golgi network.


Wu,C.,, Proteomics 7 (11), 1775-1785 (2007)Honing,S.,, Mol. Cell 18 (5), 519-531 (2005)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 80.00
Cat# BP8955b
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
30% off on 2,800+ Neuroscience Antibodies. PromoCode:<span class=text-red> FLASH20
Terms & Conditions