Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Proteins   >   BNP, human recombinant protein   

BNP, human recombinant protein

NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product info
Primary Accession P16860
Calculated MW 3.464 kDa
Additional Info
Gene ID 4879
Gene Symbol BNP
Other Names NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide, Gamma-brain natriuretic peptide
Gene Source Human
Source Synthetic
Assay&Purity SDS-PAGE; ≥98%
Assay2&Purity2 HPLC; ≥98%
Recombinant No
Sequence SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH
Application Notes Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffers.
Format Lyophilized protein
Storage -20°C; Lyophilized with no additives
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It helps to restore the body's salt and H₂O balance and improves heart function. B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 275.00
Cat# PBV10459r
Size:
Quantity:
Availability: 5-7days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Crown Flash17-30% Off
Terms & Conditions