Foundational characteristics of cancer include proliferation, angiogenesis, migration, evasion of apoptosis, and cellular immortality. Find key markers for these cellular processes and antibodies to detect them.
The SUMOplot™ Analysis Program predicts and scores sumoylation sites in your protein. SUMOylation is a post-translational modification involved in various cellular processes, such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress, and progression through the cell cycle.
The Autophagy Receptor Motif Plotter predicts and scores autophagy receptor binding sites in your protein. Identifying proteins connected to this pathway is critical to understanding the role of autophagy in physiological as well as pathological processes such as development, differentiation, neurodegenerative diseases, stress, infection, and cancer.
BTC, human recombinant protein
Betacellulin, BTC
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
| Primary Accession | P35070 |
|---|---|
| Calculated MW | 9.0 kDa |
| Gene ID | 685 |
|---|---|
| Gene Symbol | BTC |
| Other Names | Betacellulin, BTC, Probetacellulin |
| Gene Source | Human |
| Source | E. coli |
| Assay&Purity | SDS-PAGE; ≥97% |
| Assay2&Purity2 | HPLC; ≥97% |
| Recombinant | Yes |
| Sequence | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVA EQTPSCVCDEGYIGARCERVDLFY |
| Application Notes | Centrifuge the vial prior to opening. Reconstitute in sterile distilled H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffers. |
| Format | Lyophilized protein |
| Storage | -20°C; Lyophilized after extensive dialysis against 20 mM phosphate buffer, pH 7.4. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Human Betacellulin (BTC) is a potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. The effects of betacellulin are probably mediated by the egf receptor and other related receptors. Human Recombinant BTC produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 80 amino acids and having a molecular mass of 9 kDa. BTC was purified by proprietary chromatographic techniques.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.
Ordering Information
Other Products
Shipping Information
